p57 Kip2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.

Analysis in human placenta and lymph node tissues using NBP1-89917 antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Staining of human lymph node shows no nuclear positivity in germinal center cells as expected.

Staining of human pancreas shows strong nuclear positivity in islets of Langerhans.

Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells.

Analysis in human placenta tissue.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p57 Kip2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p57 Kip2 Antibody - BSA Free (NBP1-89917) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-p57 Kip2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDKN1C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p57 Kip2 Protein (NBP1-89917PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p57 Kip2 Antibody - BSA Free

• Beckwith-Wiedemann syndrome
• BWS
• cyclin-dependent kinase inhibitor 1C (p57, Kip2)
• cyclin-dependent kinase inhibitor 1C
• Cyclin-dependent kinase inhibitor p57
• KIP2BWCR
• p57
• p57Kip2
• WBS

Background

p57kip2 is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p57 Kip2 Antibody (NBP1-89917)(2)

Publications using NBP1-89917

• Luo HL, Lee YC, Chang YL et al. MicroRNA-145-5p suppresses cell proliferation, migration, and invasion in upper tract urothelial carcinoma by targeting 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase Journal of cellular biochemistry 2023-07-20 [PMID: 37475541]
• Mochizuki M, Tamai K, Imai T et al. CD271 regulates the proliferation and motility of hypopharyngeal cancer cells. Sci Rep. 2016-07-29 [PMID: 27469492] (WB, Human)

Bioinformatics

• Gene Symbol: CDKN1C