p57 Kip2 Antibody

Images

 
Western Blot: p57 Kip2 Antibody [NBP1-89917] - Analysis in human placenta tissue.
Immunocytochemistry/ Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human placenta shows strong nuclear positivity in decidual cells.
Immunocytochemistry/ Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p57 Kip2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDKN1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p57 Kip2 Protein (NBP1-89917PEP)
Publications
Read Publication using
NBP1-89917 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p57 Kip2 Antibody

  • Beckwith-Wiedemann syndrome
  • BWS
  • cyclin-dependent kinase inhibitor 1C (p57, Kip2)
  • cyclin-dependent kinase inhibitor 1C
  • Cyclin-dependent kinase inhibitor p57
  • KIP2BWCR
  • p57
  • p57Kip2
  • WBS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB6798
Species: Hu
Applications: WB, ICC
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00056996-R01
Species: Hu

Publications for p57 Kip2 Antibody (NBP1-89917)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for p57 Kip2 Antibody (NBP1-89917) (0)

There are no reviews for p57 Kip2 Antibody (NBP1-89917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p57 Kip2 Antibody (NBP1-89917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p57 Kip2 Products

Bioinformatics Tool for p57 Kip2 Antibody (NBP1-89917)

Discover related pathways, diseases and genes to p57 Kip2 Antibody (NBP1-89917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p57 Kip2 Antibody (NBP1-89917)

Discover more about diseases related to p57 Kip2 Antibody (NBP1-89917).
 

Pathways for p57 Kip2 Antibody (NBP1-89917)

View related products by pathway.

PTMs for p57 Kip2 Antibody (NBP1-89917)

Learn more about PTMs related to p57 Kip2 Antibody (NBP1-89917).
 

Research Areas for p57 Kip2 Antibody (NBP1-89917)

Find related products by research area.

Blogs on p57 Kip2

There are no specific blogs for p57 Kip2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p57 Kip2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN1C