GDF-11/BMP-11 Antibody


Western Blot: GDF-11/BMP-11 Antibody [NBP2-57399] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GDF-11/BMP-11 Antibody [NBP2-57399] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: GDF-11/BMP-11 Antibody [NBP2-57399] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: GDF-11/BMP-11 Antibody [NBP2-57399] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GDF-11/BMP-11 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT
Specificity of human GDF-11/BMP-11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GDF-11/BMP-11 Recombinant Protein Antigen (NBP2-57399PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GDF-11/BMP-11 Antibody

  • BMP11
  • BMP-11
  • BMP-11BMP11Bone morphogenetic protein 11
  • GDF11
  • GDF-11
  • growth differentiation factor 11
  • growth/differentiation factor 11


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP, ICC
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, Block
Species: Hu
Applications: WB, ELISA, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Block, KO
Species: Rt
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, Block
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GDF-11/BMP-11 Antibody (NBP2-57399) (0)

There are no publications for GDF-11/BMP-11 Antibody (NBP2-57399).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-11/BMP-11 Antibody (NBP2-57399) (0)

There are no reviews for GDF-11/BMP-11 Antibody (NBP2-57399). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-11/BMP-11 Antibody (NBP2-57399) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GDF-11/BMP-11 Products

Bioinformatics Tool for GDF-11/BMP-11 Antibody (NBP2-57399)

Discover related pathways, diseases and genes to GDF-11/BMP-11 Antibody (NBP2-57399). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-11/BMP-11 Antibody (NBP2-57399)

Discover more about diseases related to GDF-11/BMP-11 Antibody (NBP2-57399).

Pathways for GDF-11/BMP-11 Antibody (NBP2-57399)

View related products by pathway.

PTMs for GDF-11/BMP-11 Antibody (NBP2-57399)

Learn more about PTMs related to GDF-11/BMP-11 Antibody (NBP2-57399).

Research Areas for GDF-11/BMP-11 Antibody (NBP2-57399)

Find related products by research area.

Blogs on GDF-11/BMP-11

There are no specific blogs for GDF-11/BMP-11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GDF-11/BMP-11 Antibody and receive a gift card or discount.


Gene Symbol GDF11