Follistatin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPIS |
| Predicted Species |
Mouse (96%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FST |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Follistatin Antibody - BSA Free
Background
FST, also known as Follistatin, has a 344 amino acid long isoform that is 38 kDa and a short 317 amino acid that is 35 kDa, functions as an activin antagonist binding directly to it and inhibits the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH). Studies of this protein are being performed in relation to polycystic ovary syndrome, pituitary adenoma, insulin resistance, Down syndrome, plasmacytoma, lymphocytic leukemia, pituitary tumor infertility, endometrial carcinoma, teratocarcinoma, azoospermia, meningitis, hepatocellular carcinoma, ovarian carcinoma, liver disease, endometriosis, prostate carcinoma, prostatitis, ovarian cancer, and adenoma. This protein has been also shown to have interactions with ANG, DIP2A, BMP4, FN1, and TXN in signal transduction activin A signaling regulation and TGF-beta signaling pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Follistatin Antibody (NBP3-21237) (0)
There are no publications for Follistatin Antibody (NBP3-21237).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Follistatin Antibody (NBP3-21237) (0)
There are no reviews for Follistatin Antibody (NBP3-21237).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Follistatin Antibody (NBP3-21237) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Follistatin Products
Research Areas for Follistatin Antibody (NBP3-21237)
Find related products by research area.
|
Blogs on Follistatin