TST Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining in human colon and lymph node tissues using anti-TST antibody. Corresponding TST RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon, kidney, liver and pancreas using Anti-TST antibody NBP1-87148 (A) shows similar protein distribution ...read more
Western Blot: TST Antibody [NBP1-87148] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human kidney.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human pancreas.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human liver.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon using Anti-TST antibody NBP1-87148.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TST Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPS
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TST
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TST Protein (NBP1-87148PEP)
Publications
Read Publication using NBP1-87148.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TST Antibody

  • EC 2.8.1
  • EC 2.8.1.1
  • MGC19578
  • RDSRhodanese
  • thiosulfate sulfurtransferase (rhodanese)
  • thiosulfate sulfurtransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
DFN00
Species: Hu
Applications: ELISA
NB300-137
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-16604
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89366
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-10377
Species: Hu
Applications: WB
NBP1-82617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00010908-M08
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF-249-NA
Species: Hu
Applications: Neut, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for TST Antibody (NBP1-87148)(1)


Reviews for TST Antibody (NBP1-87148) (0)

There are no reviews for TST Antibody (NBP1-87148). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TST Antibody (NBP1-87148) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TST Products

Bioinformatics Tool for TST Antibody (NBP1-87148)

Discover related pathways, diseases and genes to TST Antibody (NBP1-87148). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TST Antibody (NBP1-87148)

Discover more about diseases related to TST Antibody (NBP1-87148).
 

Pathways for TST Antibody (NBP1-87148)

View related products by pathway.

PTMs for TST Antibody (NBP1-87148)

Learn more about PTMs related to TST Antibody (NBP1-87148).

Blogs on TST

There are no specific blogs for TST, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TST