PLOD1 Antibody


Orthogonal Strategies: Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) more

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PLOD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry-Paraffin
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in IHC-P reported in scientific literature (PMID:34400365).
Control Peptide
PLOD1 Protein (NBP2-38770PEP)
Read Publications using
NBP2-38770 in the following applications:

  • 1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27119146). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLOD1 Antibody

  • 2-oxoglutarate 5-dioxygenase 1
  • EC
  • Ehlers-Danlos syndrome type VI)
  • FLJ42041
  • LH1
  • LLH
  • lysine hydroxylase
  • Lysyl hydroxylase 1
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
  • procollagen-lysine
  • procollagen-lysine, 2-oxoglutarate 5-dioxygenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB, IHC-P

Publications for PLOD1 Antibody (NBP2-38770)(3)

Reviews for PLOD1 Antibody (NBP2-38770) (0)

There are no reviews for PLOD1 Antibody (NBP2-38770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLOD1 Antibody (NBP2-38770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLOD1 Products

Array NBP2-38770

Bioinformatics Tool for PLOD1 Antibody (NBP2-38770)

Discover related pathways, diseases and genes to PLOD1 Antibody (NBP2-38770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLOD1 Antibody (NBP2-38770)

Discover more about diseases related to PLOD1 Antibody (NBP2-38770).

Pathways for PLOD1 Antibody (NBP2-38770)

View related products by pathway.

PTMs for PLOD1 Antibody (NBP2-38770)

Learn more about PTMs related to PLOD1 Antibody (NBP2-38770).

Research Areas for PLOD1 Antibody (NBP2-38770)

Find related products by research area.

Blogs on PLOD1

There are no specific blogs for PLOD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLOD1 Antibody and receive a gift card or discount.


Gene Symbol PLOD1