Follistatin Antibody - BSA Free

Western Blot: Follistatin Antibody [NBP1-57996] - Jurkat cell lysate, concentration 2.5 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Follistatin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FST(follistatin) The peptide sequence was selected from the C terminal of FST. Peptide sequence SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FST
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Follistatin Antibody - BSA Free

• follistatin isoform FST317
• Follistatin
• FS
• FSActivin-binding protein
• FST

Background

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Follistatin Antibody (NBP1-57996). (Showing 1 - 1 of 1 FAQ).

1. Can I use NBP1-57996 Follistatin Antibody for neutralization in living mouse?
   • NBP1-57996 has only been validated in Western blot and is not suitable for blocking/neutralizing experiments. I searched in our product database and unfortunately we do not have any other alternatives I can recommend.

Bioinformatics

• Gene Symbol: FST
• Uniprot:
  • Q6FHE1(Human)