FGF-4 Antibody - BSA Free

Immunohistochemistry-Paraffin: FGF-4 Antibody [NBP1-83291] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts and leydig cells.

Analysis in control (vector only transfected HEK293T lysate) and FGF4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FGF-4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FGF-4 Antibody - BSA Free (NBP1-83291) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGF4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FGF-4 Protein (NBP1-83291PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FGF-4 Antibody - BSA Free

• FGF4
• FGF-4
• fibroblast growth factor 4
• HBGF-4
• HBGF-4Transforming protein KS3
• heparin secretory transforming protein 1
• Heparin secretory-transforming protein 1
• Heparin-binding growth factor 4
• HST-1
• HST-1HSTF-1
• HSTF1fibroblast growth factor 4 splice isoform
• HSTFGF-4
• human stomach cancer, transforming factor from FGF-related oncogene
• kaposi sarcoma oncogene
• KFGF
• K-FGF
• KS3
• oncogene HST

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for FGF-4 Antibody (NBP1-83291). (Showing 1 - 1 of 1 FAQ).

1. I have just apllied FGF4 to oral tissue and have seen cell surface staining and cytoplasmic. Is this true?
   • FGF4 is a secreted protein. It binds to its receptor on the cell surface and the receptor and ligand are known to translocate to the cytomplasm and nucleus. The staining you are seeing sounds like it is correct.

Bioinformatics

• Gene Symbol: FGF4