FGF-4 Antibody


Western Blot: FGF4 Antibody [NBP1-83291] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: FGF4 Antibody [NBP1-83291] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts and leydig cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

FGF-4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%)
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
FGF-4 Protein (NBP1-83291PEP)

Alternate Names for FGF-4 Antibody

  • FGF4
  • fibroblast growth factor 4
  • HBGF-4
  • HBGF-4Transforming protein KS3
  • heparin secretory transforming protein 1
  • Heparin secretory-transforming protein 1
  • Heparin-binding growth factor 4
  • HST-1
  • HST-1HSTF-1
  • HSTF1fibroblast growth factor 4 splice isoform
  • HSTFGF-4
  • human stomach cancer, transforming factor from FGF-related oncogene
  • kaposi sarcoma oncogene
  • KFGF
  • K-FGF
  • KS3
  • oncogene HST


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Neut
Species: Hu, Mu
Applications: WB, ICFlow
Species: Hu
Applications: WB, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for FGF-4 Antibody (NBP1-83291) (0)

There are no publications for FGF-4 Antibody (NBP1-83291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-4 Antibody (NBP1-83291) (0)

There are no reviews for FGF-4 Antibody (NBP1-83291). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-4 Antibody (NBP1-83291). (Showing 1 - 1 of 1 FAQ).

  1. I have just apllied FGF4 to oral tissue and have seen cell surface staining and cytoplasmic. Is this true?
    • FGF4 is a secreted protein. It binds to its receptor on the cell surface and the receptor and ligand are known to translocate to the cytomplasm and nucleus. The staining you are seeing sounds like it is correct.

Secondary Antibodies


Isotype Controls

Additional FGF-4 Antibody Products

Related Products by Gene

Bioinformatics Tool for FGF-4 Antibody (NBP1-83291)

Discover related pathways, diseases and genes to FGF-4 Antibody (NBP1-83291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-4 Antibody (NBP1-83291)

Discover more about diseases related to FGF-4 Antibody (NBP1-83291).

Pathways for FGF-4 Antibody (NBP1-83291)

View related products by pathway.

PTMs for FGF-4 Antibody (NBP1-83291)

Learn more about PTMs related to FGF-4 Antibody (NBP1-83291).

Research Areas for FGF-4 Antibody (NBP1-83291)

Find related products by research area.

Blogs on FGF-4

There are no specific blogs for FGF-4, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol FGF4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83291 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought