FGF-4 Antibody


Western Blot: FGF4 Antibody [NBP1-83291] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: FGF4 Antibody [NBP1-83291] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts and leydig cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FGF-4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
Specificity of human FGF-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGF-4 Protein (NBP1-83291PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FGF-4 Antibody

  • FGF4
  • FGF-4
  • fibroblast growth factor 4
  • HBGF-4
  • HBGF-4Transforming protein KS3
  • heparin secretory transforming protein 1
  • Heparin secretory-transforming protein 1
  • Heparin-binding growth factor 4
  • HST-1
  • HST-1HSTF-1
  • HSTF1fibroblast growth factor 4 splice isoform
  • HSTFGF-4
  • human stomach cancer, transforming factor from FGF-related oncogene
  • kaposi sarcoma oncogene
  • KFGF
  • K-FGF
  • KS3
  • oncogene HST


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, Neut
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for FGF-4 Antibody (NBP1-83291) (0)

There are no publications for FGF-4 Antibody (NBP1-83291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-4 Antibody (NBP1-83291) (0)

There are no reviews for FGF-4 Antibody (NBP1-83291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-4 Antibody (NBP1-83291). (Showing 1 - 1 of 1 FAQ).

  1. I have just apllied FGF4 to oral tissue and have seen cell surface staining and cytoplasmic. Is this true?
    • FGF4 is a secreted protein. It binds to its receptor on the cell surface and the receptor and ligand are known to translocate to the cytomplasm and nucleus. The staining you are seeing sounds like it is correct.

Secondary Antibodies


Isotype Controls

Additional FGF-4 Products

Bioinformatics Tool for FGF-4 Antibody (NBP1-83291)

Discover related pathways, diseases and genes to FGF-4 Antibody (NBP1-83291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-4 Antibody (NBP1-83291)

Discover more about diseases related to FGF-4 Antibody (NBP1-83291).

Pathways for FGF-4 Antibody (NBP1-83291)

View related products by pathway.

PTMs for FGF-4 Antibody (NBP1-83291)

Learn more about PTMs related to FGF-4 Antibody (NBP1-83291).

Research Areas for FGF-4 Antibody (NBP1-83291)

Find related products by research area.

Blogs on FGF-4

There are no specific blogs for FGF-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF-4 Antibody and receive a gift card or discount.


Gene Symbol FGF4