FGFR2 Antibody (1G3) - Azide and BSA Free

Western Blot: FGFR2 Antibody (1G3) [H00002263-M01] - Analysis of FGFR2 expression in transfected 293T cell line by FGFR2 monoclonal antibody (M01), clone 1G3.Lane 1: FGFR2 transfected lysate (Predicted MW: 92 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: FGFR2 Antibody (1G3) [H00002263-M01] - Analysis of monoclonal antibody to FGFR2 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. Antibody concentration 5 ug/ml.

Sandwich ELISA: FGFR2 Antibody (1G3) [H00002263-M01] - Detection limit for recombinant GST tagged FGFR2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Bv
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1G3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FGFR2 Antibody (1G3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
• Specificity: FGFR2 - fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratinocyte growth factor receptor, craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome). This antibody cross-reacts with human FGFR1 and human FGFR3.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FGFR2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 25834803).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGFR2 Antibody (1G3) - Azide and BSA Free

• BBDS
• BEK
• BFR-1
• CD332 antigen
• CD332
• CEK3
• CFD1
• craniofacial dysostosis 1
• EC 2.7.10
• EC 2.7.10.1
• ECT1
• FGF R2
• FGFR2
• fibroblast growth factor receptor 2
• FLJ98662
• Jackson-Weiss syndrome
• JWS
• Keratinocyte growth factor receptorreceptor like 14
• KGFR
• KSAM
• K-sam
• soluble FGFR4 variant 4
• TK14
• TK25

Background

The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FGFR2 Antibody (H00002263-M01)(14)

Publications using H00002263-M01

• Braun M, Durślewicz J, Sołek J et al. High FGFR4 protein expression, but not FGFR1 or FGFR2, predicts poor prognosis in pancreatic ductal adenocarcinoma BMC Cancer 2025-10-06 [PMID: 41053706]
• Kamil M, Kamila K, Marcin B et al. FGF7/FGFR2-JunB signalling counteracts the effect of progesterone in luminal breast cancer. Mol Oncol. 2022-06-20 [PMID: 35726195]
• Marcin B, Dominika P, Mateusz B et al. A 'Real-Life' Experience on Automated Digital Image Analysis of FGFR2 Immunohistochemistry in Breast Cancer. Diagnostics (Basel). 2020-12-07 [PMID: 33297384]
• Turczyk L, Kitowska K, Mieszkowska M et al. FGFR2-Driven Signaling Counteracts Tamoxifen Effect on ER?-Positive Breast Cancer Cells. Neoplasia. 2017-09-01 [PMID: 28869838]
• Czaplinska D, Mieczkowski K, Supernat A et al. Interactions between FGFR2 and RSK2-implications for breast cancer prognosis. Tumour Biol 2016-07-30 [PMID: 27476168]
• Akizawa H, Nagatomo H, Odagiri H et al. Conserved roles of fibroblast growth factor receptor 2 signaling in the regulation of inner cell mass development in bovine blastocysts. Mol Reprod Dev 2016-06-01 [PMID: 27060901]
• Yoon G, Lee H, Kim JH et al. Clinical significance of fibroblast growth factor receptor 2 expression in patients with residual rectal cancer after preoperative chemoradiotherapy: relationship with KRAS or BRAF mutations and MSI status. Tumour Biol 2016-01-30 [PMID: 26831663]
• Lee HJ, Kang HJ, Kim KM et al. Fibroblast growth factor receptor isotype expression and its association with overall survival in patients with hepatocellular carcinoma. Clin Mol Hepatol 2015-03-01 [PMID: 25834803] (IF/IHC, Human)
• Grygielewicz P, Dymek B, Bujak A et al. Epithelial-mesenchymal transition confers resistance to selective FGFR inhibitors in SNU-16 gastric cancer cells. Gastric Cancer. 2014-11-19 [PMID: 25407459]
• Cazet A, Charest J, Bennett DC et al. Mannose phosphate isomerase regulates fibroblast growth factor receptor family signaling and glioma radiosensitivity. PLoS One. 2014-10-14 [PMID: 25314669]
• Lee HJ, Seo AN, Park SY et al. Low Prognostic Implication of Fibroblast Growth Factor Family Activation in Triple-negative Breast Cancer Subsets. Ann Surg Oncol. 2014-01-03 [PMID: 24385208]
• Katano H, Yamada K, et al. Upregulation of ANGPTL4 Messenger RNA and Protein in Severely Calcified Carotid Plaques. J Stroke Cerebrovasc Dis 2013-09-26 [PMID: 24075588]
• Vermeulen JF, Kornegoor R, van der Wall E et al. Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer. PLoS One. 2013-01-04 [PMID: 23308200]
• Ozawa M, Yang QE, Ealy AD. The expression of fibroblast growth factor receptors during early bovine conceptus development and pharmacological analysis of their actions on trophoblast growth in vitro. Reproduction. 2013-01-24 [PMID: 23241344]

Bioinformatics

• Gene Symbol: FGFR2
• Entrez:
  • 2263(Human)
• OMIM:
  • 101200(Human)
• Uniprot:
  • AAH39243(Human)