Orthogonal Strategies: Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NBP1-84827] - Analysis in human endometrium and cerebral cortex tissues. Corresponding ER alpha/NR3A1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NBP1-84827] - Staining of human cerebral cortex, cervix, uterine, endometrium and gastrointestinal using Anti-ER alpha/NR3A1 ...read more
Immunocytochemistry/ Immunofluorescence: ER alpha/NR3A1 Antibody [NBP1-84827] - Staining of human cell line MCF7 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NBP1-84827] - Staining of human uterine cervix shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NBP1-84827] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NBP1-84827] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NBP1-84827] - Staining of human small intestine shows no positivity in glandular cells as expected.
Genetic Strategies: Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ESR1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Novus Biologicals Rabbit ER alpha/NR3A1 Antibody - BSA Free (NBP1-84827) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ER alpha/NR3A1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ESR1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Estrogen receptor alpha (ER alpha) is a nuclear protein and member of the steroid hormone receptor family. ER alpha possesses both DNA binding and ligand binding domains, and exerts a significant role in activating the transcription of certain genes (1). Ligand-dependent dimerization and phosphorylation on serines, 104, 106, and 118 function to regulate the transcriptional activation of ER alpha (2). The phosphorylation of the human estrogen receptor (ER) serine residue at position 118 is required for full activity of the ER activation function 1 (AF-1) (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for ER alpha/NR3A1 Antibody (NBP1-84827) (0)
There are no reviews for ER alpha/NR3A1 Antibody (NBP1-84827).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ER alpha/NR3A1 Antibody - BSA Free and receive a gift card or discount.