AKR1B1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit AKR1B1 Antibody - BSA Free (NBP1-89146) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AKR1B1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for AKR1B1 Antibody - BSA Free
Background
Aldose reductase (also designated AKR1B1, ALDR1, ALR2 or AR) is member of the monomeric NADPH-dependent aldoketoreductase family. Aldose reductase, which has a molecular mass of 36 kDa, catalyzes the reduction of various aldehydes and has been implicated in the development of diabetic complications by catalyzing the reduction of the aldehyde form of glucose, to the corresponding sugar alcohol, sorbitol. This pathway plays a minor role in glucose metabolism in most tissues, however in diabetic hyperglycemia, cells undergoing insulin-independent uptake of glucose accumulate significant quantities of sorbitol. The resulting hyperosmotic stress to cells may be a cause of diabetic complications such as neuropathy, retinopathy, and cataracts. Aldose reductase is very similar to human aldehyde reductase, bovine prostaglandin F synthase and to the European common frog protein, rho-crystallin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Publications for AKR1B1 Antibody (NBP1-89146) (0)
There are no publications for AKR1B1 Antibody (NBP1-89146).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AKR1B1 Antibody (NBP1-89146) (0)
There are no reviews for AKR1B1 Antibody (NBP1-89146).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AKR1B1 Antibody (NBP1-89146). (Showing 1 - 1 of 1 FAQ).
-
I study in HKBU and want to buy some antibodies (an anti-AKR1B1 and anti-AKR1B1). I found that there are different kinds of AKR1B1 (AR) and AKR1B10 (ARL-1) antibodies in your company. Do these antibodies cross-react with each other? Could you give me some advice about how I choose antibodies with the minimum cross-reactivity?
- Here is a link to our antibodies to AKR1B1. The cross-reactivity of these against AKR1B10 is not given and so I ran alignments against the AKR1B10 sequence for you in the instances where the immunogen sequence was disclosed. In all of these cases the homology was greater than 90%, so you would be likely to see cross-reactivity with the AKR1B10 protein. I also ran an alignment between the full length sequences of AKR1B1 and AKR1B10 and found that the homology between these two proteins is 70%. Please see this link for our AKR1B10 primary antibodies. Of these, the immunogen used to generate NBP1-44998 is listed as a highly specific 15 amino acid portion of human AKR1B10 (within amino acids 100-150). [UniProt# O60218]. This may be a suitable choice for you when detecting AKR1B10.
Secondary Antibodies
| |
Isotype Controls
|
Additional AKR1B1 Products
Research Areas for AKR1B1 Antibody (NBP1-89146)
Find related products by research area.
|
Blogs on AKR1B1