AKR1B1 Antibody


Western Blot: AKR1B1 Antibody [NBP1-89146] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: AKR1B1 Antibody [NBP1-89146] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

AKR1B1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Specificity of human AKR1B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
AKR1B1 Lysate (NBP2-64747)
Control Peptide
AKR1B1 Protein (NBP1-89146PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AKR1B1 Antibody

  • ADR
  • Aldehyde reductase
  • Aldo-keto reductase family 1 member B1
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • ALDR1aldose reductase
  • ALR2
  • ARaldehyde reductase 1
  • EC 1.1.1
  • EC
  • Lii5-2 CTCL tumor antigen
  • low Km aldose reductase
  • MGC1804


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N

Publications for AKR1B1 Antibody (NBP1-89146) (0)

There are no publications for AKR1B1 Antibody (NBP1-89146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1B1 Antibody (NBP1-89146) (0)

There are no reviews for AKR1B1 Antibody (NBP1-89146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AKR1B1 Antibody (NBP1-89146). (Showing 1 - 1 of 1 FAQ).

  1. I study in HKBU and want to buy some antibodies (an anti-AKR1B1 and anti-AKR1B1). I found that there are different kinds of AKR1B1 (AR) and AKR1B10 (ARL-1) antibodies in your company. Do these antibodies cross-react with each other? Could you give me some advice about how I choose antibodies with the minimum cross-reactivity?
    • Here is a link to our antibodies to AKR1B1. The cross-reactivity of these against AKR1B10 is not given and so I ran alignments against the AKR1B10 sequence for you in the instances where the immunogen sequence was disclosed. In all of these cases the homology was greater than 90%, so you would be likely to see cross-reactivity with the AKR1B10 protein. I also ran an alignment between the full length sequences of AKR1B1 and AKR1B10 and found that the homology between these two proteins is 70%. Please see this link for our AKR1B10 primary antibodies. Of these, the immunogen used to generate NBP1-44998 is listed as a highly specific 15 amino acid portion of human AKR1B10 (within amino acids 100-150). [UniProt# O60218]. This may be a suitable choice for you when detecting AKR1B10.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for AKR1B1 Antibody (NBP1-89146)

Discover related pathways, diseases and genes to AKR1B1 Antibody (NBP1-89146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1B1 Antibody (NBP1-89146)

Discover more about diseases related to AKR1B1 Antibody (NBP1-89146).

Pathways for AKR1B1 Antibody (NBP1-89146)

View related products by pathway.

PTMs for AKR1B1 Antibody (NBP1-89146)

Learn more about PTMs related to AKR1B1 Antibody (NBP1-89146).

Research Areas for AKR1B1 Antibody (NBP1-89146)

Find related products by research area.

Blogs on AKR1B1

There are no specific blogs for AKR1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AKR1B1 Antibody and receive a gift card or discount.


Gene Symbol AKR1B1