We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

AKR1B1 Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human adrenal gland shows moderate to strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry: AKR1B1 Antibody [NBP1-89146] - Staining of human colon shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

AKR1B1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKR1B1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
AKR1B1 Protein (NBP1-89146PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AKR1B1 Antibody - BSA Free

  • ADR
  • Aldehyde reductase
  • Aldo-keto reductase family 1 member B1
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • ALDR1aldose reductase
  • ALR2
  • ARaldehyde reductase 1
  • EC 1.1.1
  • EC 1.1.1.21
  • Lii5-2 CTCL tumor antigen
  • low Km aldose reductase
  • MGC1804

Background

Aldose reductase (also designated AKR1B1, ALDR1, ALR2 or AR) is member of the monomeric NADPH-dependent aldoketoreductase family. Aldose reductase, which has a molecular mass of 36 kDa, catalyzes the reduction of various aldehydes and has been implicated in the development of diabetic complications by catalyzing the reduction of the aldehyde form of glucose, to the corresponding sugar alcohol, sorbitol. This pathway plays a minor role in glucose metabolism in most tissues, however in diabetic hyperglycemia, cells undergoing insulin-independent uptake of glucose accumulate significant quantities of sorbitol. The resulting hyperosmotic stress to cells may be a cause of diabetic complications such as neuropathy, retinopathy, and cataracts. Aldose reductase is very similar to human aldehyde reductase, bovine prostaglandin F synthase and to the European common frog protein, rho-crystallin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-90233
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-35880
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-62658
Species: Hu
Applications: IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DY413
Species: Mu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP1-87415
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB

Publications for AKR1B1 Antibody (NBP1-89146) (0)

There are no publications for AKR1B1 Antibody (NBP1-89146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1B1 Antibody (NBP1-89146) (0)

There are no reviews for AKR1B1 Antibody (NBP1-89146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKR1B1 Antibody (NBP1-89146). (Showing 1 - 1 of 1 FAQ).

  1. I study in HKBU and want to buy some antibodies (an anti-AKR1B1 and anti-AKR1B1). I found that there are different kinds of AKR1B1 (AR) and AKR1B10 (ARL-1) antibodies in your company. Do these antibodies cross-react with each other? Could you give me some advice about how I choose antibodies with the minimum cross-reactivity?
    • Here is a link to our antibodies to AKR1B1. The cross-reactivity of these against AKR1B10 is not given and so I ran alignments against the AKR1B10 sequence for you in the instances where the immunogen sequence was disclosed. In all of these cases the homology was greater than 90%, so you would be likely to see cross-reactivity with the AKR1B10 protein. I also ran an alignment between the full length sequences of AKR1B1 and AKR1B10 and found that the homology between these two proteins is 70%. Please see this link for our AKR1B10 primary antibodies. Of these, the immunogen used to generate NBP1-44998 is listed as a highly specific 15 amino acid portion of human AKR1B10 (within amino acids 100-150). [UniProt# O60218]. This may be a suitable choice for you when detecting AKR1B10.

Secondary Antibodies

 

Isotype Controls

Additional AKR1B1 Products

Research Areas for AKR1B1 Antibody (NBP1-89146)

Find related products by research area.

Blogs on AKR1B1

There are no specific blogs for AKR1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKR1B1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1B1