Ferredoxin Reductase Antibody (NBP2-38530)

Images

 
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ferredoxin Reductase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FDXR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
Ferredoxin Reductase Protein (NBP2-38530PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ferredoxin Reductase Antibody

  • Adrenodoxin reductase
  • ADXREC 1.18.1.2
  • ferredoxin reductaseAR
  • Ferredoxin--NADP(+) reductase
  • NADPH:adrenodoxin oxidoreductase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for Ferredoxin Reductase Antibody (NBP2-38530) (0)

There are no publications for Ferredoxin Reductase Antibody (NBP2-38530).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ferredoxin Reductase Antibody (NBP2-38530) (0)

There are no reviews for Ferredoxin Reductase Antibody (NBP2-38530). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ferredoxin Reductase Antibody (NBP2-38530) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ferredoxin Reductase Products

Related Products by Gene

Bioinformatics Tool for Ferredoxin Reductase Antibody (NBP2-38530)

Discover related pathways, diseases and genes to Ferredoxin Reductase Antibody (NBP2-38530). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ferredoxin Reductase Antibody (NBP2-38530)

Discover more about diseases related to Ferredoxin Reductase Antibody (NBP2-38530).
 

Pathways for Ferredoxin Reductase Antibody (NBP2-38530)

View related products by pathway.

PTMs for Ferredoxin Reductase Antibody (NBP2-38530)

Learn more about PTMs related to Ferredoxin Reductase Antibody (NBP2-38530).

Blogs on Ferredoxin Reductase

There are no specific blogs for Ferredoxin Reductase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ferredoxin Reductase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FDXR
Uniprot