Recombinant Human PRH2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRH2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 166 of Human PRH2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PRH2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRH2 Protein

  • Db-s
  • MGC74956
  • PaParotid acidic protein
  • Parotid double-band protein
  • Parotid isoelectric focusing variant protein
  • Parotid proline-rich protein 1/2
  • PIF-S
  • Pr1/Pr2
  • proline-rich protein HaeIII subfamily 1
  • Protein C
  • PRP-1/PRP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1267
Species: Hu
Applications: WB, IP, Neut
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PRH2 Recombinant Protein (H00005555-P01) (0)

There are no publications for PRH2 Recombinant Protein (H00005555-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRH2 Recombinant Protein (H00005555-P01) (0)

There are no reviews for PRH2 Recombinant Protein (H00005555-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRH2 Recombinant Protein (H00005555-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRH2 Products

PRH2 H00005555-P01

Bioinformatics Tool for PRH2 Recombinant Protein (H00005555-P01)

Discover related pathways, diseases and genes to PRH2 Recombinant Protein (H00005555-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRH2 Recombinant Protein (H00005555-P01)

Discover more about diseases related to PRH2 Recombinant Protein (H00005555-P01).
 

Pathways for PRH2 Recombinant Protein (H00005555-P01)

View related products by pathway.

PTMs for PRH2 Recombinant Protein (H00005555-P01)

Learn more about PTMs related to PRH2 Recombinant Protein (H00005555-P01).

Blogs on PRH2

There are no specific blogs for PRH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRH2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRH2