CYP11B1 Antibody

Images

 
Immunohistochemistry-Paraffin: CYP11B1 Antibody [NBP2-49223] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: CYP11B1 Antibody [NBP2-49223] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CYP11B1 Antibody [NBP2-49223] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: CYP11B1 Antibody [NBP2-49223] - Staining of human rectum shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP11B1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP11B1 Recombinant Protein Antigen (NBP2-49223PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP11B1 Antibody

  • CPN1
  • CYP11B1
  • CYPXIB1
  • cytochrome P450 11B1, mitochondrial
  • cytochrome p450 XIB1
  • cytochrome P450, family 11, subfamily B, polypeptide 1
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1
  • Cytochrome P450C11
  • Cytochrome P-450c11
  • EC 1.14.15
  • EC 1.14.15.4
  • FHICYP11B
  • FLJ36771
  • P450C11DKFZp686B05283
  • S11BH
  • Steroid 11-beta-hydroxylase
  • steroid 11-beta-monooxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92862
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-13893
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB100-62346
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-33485
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-04160
Species: Hu
Applications: WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-49223
Species: Hu
Applications: IHC, IHC-P

Publications for CYP11B1 Antibody (NBP2-49223) (0)

There are no publications for CYP11B1 Antibody (NBP2-49223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11B1 Antibody (NBP2-49223) (0)

There are no reviews for CYP11B1 Antibody (NBP2-49223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CYP11B1 Antibody (NBP2-49223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11B1 Products

Bioinformatics Tool for CYP11B1 Antibody (NBP2-49223)

Discover related pathways, diseases and genes to CYP11B1 Antibody (NBP2-49223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11B1 Antibody (NBP2-49223)

Discover more about diseases related to CYP11B1 Antibody (NBP2-49223).
 

Pathways for CYP11B1 Antibody (NBP2-49223)

View related products by pathway.

PTMs for CYP11B1 Antibody (NBP2-49223)

Learn more about PTMs related to CYP11B1 Antibody (NBP2-49223).
 

Research Areas for CYP11B1 Antibody (NBP2-49223)

Find related products by research area.

Blogs on CYP11B1

There are no specific blogs for CYP11B1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP11B1