CYP11B2 Antibody


Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of adrenal gland shows strong cytoplasmic positivity in cortical cells.
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of adrenal gland shows strong cytoplasmic positivity in cortical cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CYP11B2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
Specificity of human CYP11B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP11B2 Protein (NBP2-13891PEP)
Read Publication using NBP2-13891.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CYP11B2 Antibody

  • Aldosterone synthase
  • Aldosterone-synthesizing enzyme
  • CPN2
  • CYP11BL
  • cytochrome P450 11B2, mitochondrial
  • cytochrome P450, family 11, subfamily B, polypeptide 2
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
  • Cytochrome P-450Aldo
  • Cytochrome P-450C18
  • EC 1.14.15
  • EC
  • EC
  • mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2
  • P450aldo
  • P450C18
  • P-450C18
  • steroid 11-beta/18-hydroxylase
  • steroid 11-beta-monooxygenase
  • Steroid 18-hydroxylase
  • steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Mk
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, IHC, IP

Publications for CYP11B2 Antibody (NBP2-13891)(1)

We have publications tested in 1 confirmed species: Human.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CYP11B2 Antibody (NBP2-13891) (0)

There are no reviews for CYP11B2 Antibody (NBP2-13891). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CYP11B2 Antibody (NBP2-13891) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CYP11B2 Antibody (NBP2-13891)

Discover related pathways, diseases and genes to CYP11B2 Antibody (NBP2-13891). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11B2 Antibody (NBP2-13891)

Discover more about diseases related to CYP11B2 Antibody (NBP2-13891).

Pathways for CYP11B2 Antibody (NBP2-13891)

View related products by pathway.

PTMs for CYP11B2 Antibody (NBP2-13891)

Learn more about PTMs related to CYP11B2 Antibody (NBP2-13891).

Research Areas for CYP11B2 Antibody (NBP2-13891)

Find related products by research area.

Blogs on CYP11B2

There are no specific blogs for CYP11B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP11B2 Antibody and receive a gift card or discount.


Gene Symbol CYP11B2