CYP11B2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Analysis in human adrenal gland and tonsil tissues using NBP2-13891 antibody. Corresponding CYP11B2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of human Liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of human Adrenal gland shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of human Endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CYP11B2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CYP11B2 Antibody - BSA Free (NBP2-13891) is a polyclonal antibody validated for use in IHC. Anti-CYP11B2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYP11B2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CYP11B2 Protein (NBP2-13891PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CYP11B2 Antibody - BSA Free

• ALDOS
• ALDOSCYP11B
• Aldosterone synthase
• Aldosterone-synthesizing enzyme
• CPN2
• CYP11B2
• CYP11BL
• CYPXIB2
• cytochrome P450 11B2, mitochondrial
• cytochrome P450, family 11, subfamily B, polypeptide 2
• cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
• Cytochrome P-450Aldo
• Cytochrome P-450C18
• EC 1.14.15
• EC 1.14.15.4
• EC 1.14.15.5
• mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2
• P450aldo
• P450C18
• P-450C18
• steroid 11-beta/18-hydroxylase
• steroid 11-beta-monooxygenase
• Steroid 18-hydroxylase
• steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo

Background

The CYP11B2 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. This protein localiz

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CYP11B2 Antibody (NBP2-13891)(3)

Publications using NBP2-13891

• Hannah-Shmouni F, Berthon A, Faucz FR et al. Mass spectrometry-based steroid profiling in primary bilateral macronodular adrenocortical hyperplasia Endocrine-Related Cancer 2020-07-01 [PMID: 32348959] (Human)
• Berthon, A;Hannah-Shmouni, F;Maria, AG;Faucz, FR;Stratakis, CA; High expression of adrenal P450 aromatase (CYP19A1) in association with ARMC5-primary bilateral macronodular adrenocortical hyperplasia J. Steroid Biochem. Mol. Biol. 2019-04-20 [PMID: 31014964] (Human)
• Scortegagna M, Berthon A, Settas N et al. The E3 ubiquitin ligase Siah1 regulates adrenal gland organization and aldosterone secretion. JCI Insight 2017-12-07 [PMID: 29212953] (Human)

Bioinformatics

• Gene Symbol: CYP11B2