CYP11A1 Antibody

Images

 
Western Blot: CYP11A1 Antibody [NBP2-92879] - Analysis of extracts of HeLa cells, using CYP11A1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug ...read more
Immunohistochemistry: CYP11A1 Antibody [NBP2-92879] - Immunofluorescence analysis of human placenta using CYP11A1 Rabbit pAb (NBP2-92879) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: CYP11A1 Antibody [NBP2-92879] - Analysis of extracts of various cell lines, using CYP11A1 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Western Blot: CYP11A1 Antibody [NBP2-92879] - Analysis of extracts of various cell lines, using CYP11A1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP2-92879] - Human colon using CYP11A1 Rabbit pAb at dilution of 1:100 (40x lens).
Immunohistochemistry: CYP11A1 Antibody [NBP2-92879] - Immunofluorescence analysis of rat adrenal gland using CYP11A1 Rabbit pAb (NBP2-92879) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: CYP11A1 Antibody [NBP2-92879] - Immunofluorescence analysis of mouse adrenal gland using CYP11A1 Rabbit pAb (NBP2-92879) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP11A1 Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 41-308 of CYP11A1 (NP_000772.2). STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:20-1:50
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 1:500 - 1:2000
Reviewed Applications
Read 1 Review rated 5
using
NBP2-92879 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CYP11A1 Antibody

  • Cholesterol desmolase
  • cholesterol monooxygenase (side-chain-cleaving)
  • cholesterol side-chain cleavage enzyme, mitochondrial
  • CYPXIA1
  • Cytochrome P450 11A1
  • Cytochrome P450(scc)
  • cytochrome P450, family 11, subfamily A, polypeptide 1
  • cytochrome P450C11A1
  • EC 1.14.15
  • EC 1.14.15.6
  • steroid 20-22-lyase
  • subfamily XIA (cholesterol side chain cleavage)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-68883
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-92862
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-13893
Species: Hu
Applications: IHC, IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYP11A1 Antibody (NBP2-92879) (0)

There are no publications for CYP11A1 Antibody (NBP2-92879).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CYP11A1 Antibody (NBP2-92879) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-92879:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CYP11A1 NBP2-92879
Enlarge
5
reviewed by:
Marina Villar
WB Human 08/17/2021
View

Summary

ApplicationWestern Blot
Sample TestedHuman primary fibroblast
SpeciesHuman
Lot3507018002

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYP11A1 Antibody (NBP2-92879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11A1 Products

Bioinformatics Tool for CYP11A1 Antibody (NBP2-92879)

Discover related pathways, diseases and genes to CYP11A1 Antibody (NBP2-92879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11A1 Antibody (NBP2-92879)

Discover more about diseases related to CYP11A1 Antibody (NBP2-92879).
 

Pathways for CYP11A1 Antibody (NBP2-92879)

View related products by pathway.

PTMs for CYP11A1 Antibody (NBP2-92879)

Learn more about PTMs related to CYP11A1 Antibody (NBP2-92879).
 

Research Areas for CYP11A1 Antibody (NBP2-92879)

Find related products by research area.

Blogs on CYP11A1

There are no specific blogs for CYP11A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Marina Villar
08/17/2021
Application: WB
Species: Human

Bioinformatics

Gene Symbol CYP11A1