CYP21A2 Antibody


Western Blot: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland tissue.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining in human adrenal gland and pancreas tissues using anti-CYP21A2 antibody. Corresponding CYP21A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland, cerebral cortex, kidney and testis using Anti-CYP21A2 antibody NBP2-13893 (A) shows similar protein distribution across more
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CYP21A2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKL VSRNYPDLSLGDYSLLW
Specificity of human CYP21A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Adrenal Lysate (NB820-59171)
Control Peptide
CYP21A2 Protein (NBP2-13893PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CYP21A2 Antibody

  • 21-OHase
  • CA21HCYP21B
  • CAH1
  • CPS1
  • CYP21EC
  • Cytochrome P450 21
  • Cytochrome P450 XXI
  • cytochrome P450, family 21, subfamily A, polypeptide 2
  • cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenalhyperplasia), polypeptide 2
  • Cytochrome P-450c21
  • Cytochrome P450-C21
  • Cytochrome P450-C21B
  • EC 1.14.99
  • MGC150536
  • MGC150537
  • P450c21B
  • steroid 21-hydroxylase
  • steroid 21-monooxygenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
Species: Hu, Mu, Mk
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: Flow, PAGE, IF
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CYP21A2 Antibody (NBP2-13893) (0)

There are no publications for CYP21A2 Antibody (NBP2-13893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP21A2 Antibody (NBP2-13893) (0)

There are no reviews for CYP21A2 Antibody (NBP2-13893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP21A2 Antibody (NBP2-13893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CYP21A2 Antibody (NBP2-13893)

Discover related pathways, diseases and genes to CYP21A2 Antibody (NBP2-13893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP21A2 Antibody (NBP2-13893)

Discover more about diseases related to CYP21A2 Antibody (NBP2-13893).

Pathways for CYP21A2 Antibody (NBP2-13893)

View related products by pathway.

PTMs for CYP21A2 Antibody (NBP2-13893)

Learn more about PTMs related to CYP21A2 Antibody (NBP2-13893).

Research Areas for CYP21A2 Antibody (NBP2-13893)

Find related products by research area.

Blogs on CYP21A2

There are no specific blogs for CYP21A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP21A2 Antibody and receive a gift card or discount.


Gene Symbol CYP21A2