Home » CYP11B1 » CYP11B1 Antibodies » CYP11B1 Antibody

CYP11B1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CYP11B1 Antibody [H00001584-D01P] - Analysis of CYP11B1 expression in transfected 293T cell line by CYP11B1 polyclonal antibody.Lane 1: CYP11B1 transfected lysate(65.10 KDa).Lane 2: Non-transfected lysate.
Western Blot: CYP11B1 Antibody [H00001584-D01P] - Analysis of CYP11B1 expression in transfected 293T cell line by CYP11B1 polyclonal antibody.Lane 1: CYP11B1 transfected lysate(65.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CYP11B1 Antibody Summary

Immunogen
CYP11B1 (AAH96285.1, 1 a.a. - 574 a.a.) full-length human protein. MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
Specificity
Reacts with cytochrome P450, family 11, subfamily B, polypeptide 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP11B1 Antibody

  • CPN1
  • CYP11B1
  • CYPXIB1
  • cytochrome P450 11B1, mitochondrial
  • cytochrome p450 XIB1
  • cytochrome P450, family 11, subfamily B, polypeptide 1
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1
  • Cytochrome P450C11
  • Cytochrome P-450c11
  • EC 1.14.15
  • EC 1.14.15.4
  • FHICYP11B
  • FLJ36771
  • P450C11DKFZp686B05283
  • S11BH
  • Steroid 11-beta-hydroxylase
  • steroid 11-beta-monooxygenase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CYP11B2 Antibody
NBP2-92862
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-92862] - Mouse adrenal gland using CYP11B2 antibody at dilution of 1:100 (40x lens).
Western Blot: CYP11B2 Antibody [NBP2-92862] - Analysis of extracts of various cell lines, using CYP11B2 .Exposure time: 20s.
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-92862] - Rat adrenal gland using CYP11B2 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CYP21A2 Antibody
NBP2-13893
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.
Species: Hu
Applications: IHC, IHC-P, WB
CYP11A1 Antibody
NBP1-85368
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining in human adrenal gland and cerebral cortex tissues using anti-CYP11A1 antibody. Corresponding CYP11A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining of human cerebral cortex shows low expression as expected.
(4 Reviews)
(3 Publications)
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB

SF-1/NR5A1/Steroidogen ...
NBP2-88921
Immunocytochemistry/Immunofluorescence: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of U-2 OS cells using the Anti-NR5A1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of human adrenal gland shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of human breast shows weak to moderate nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in 13 year old testis. Immunoexpression in Leydig cell. Image from a verified customer review.
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in macaque Leydig cells. Image from a verified customer review.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Hela cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(5 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody - BSA Free [NBP1-30027] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of Serpin A8 (NBP1-30027) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC, IP, Neut, WB
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Western Blot: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control (C; open bar; n = 6) and hypothyroid (Hypo; solid bar; n = 6) rabbits. Representative immunoblot showing the expression of aromatase. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of hypothyroid (Hypo; solid bar; n = 6) rabbits. Immunoreactivity of antiaromatase (+) was identified in granulosa cells of antral follicles (tertiary, tf; Graafian, gf) of hypothyroid ovaries. Nonlabeling was observed when the primary antibody was omitted. Bars: 100 um (1st image); and 20 um (2nd image). Granulose cells, gc; theca cells, tc. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
StAR Antibody
NBP1-33485
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-33485] - Human hepatoma. StAR antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Immunocytochemistry/Immunofluorescence: StAR Antibody [NBP1-33485] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: StAR protein stained by StAR antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: StAR Antibody [NBP1-33485] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with StAR antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(3 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Melanocortin-2
R/MC2R Overexpression ...
NBP2-04160
Western Blot: MC2 Receptor Overexpression Lysate (Adult Normal) [NBP2-04160] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for MC2 Receptor.
(1 Review)
Species: Hu
Applications: WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Immunohistochemistry-Paraffin: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Both normal and cancer biopsies of deparaffinized Human tonsil tissues.
Western Blot: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Analysis of Mineralocorticoid Receptor.
Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Mineralocorticoid Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mineralocorticoid Receptor at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Beta
Hydroxysteroid Dehydr ...
NBP1-32353
Immunohistochemistry-Paraffin: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-32353] - Human normal liver. HSD3B2 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-32353] - Sample (30 ug of whole cell lysate)A:HeLa S3 B:MOLT4 12% SDS PAGE, antibody diluted at 1:500.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LRH-1/NR5A2
Antibody
NBP2-27196
Immunohistochemistry-Paraffin: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2/LRH1 in human pancreas tissue using NR5A2/LRH1 antibody at 5 ug/ml.
Western Blot: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2 in HEPG2 lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse NIH3T3 and 4) RAW lysate probed with 3 ug/ml of NR5A2 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Publication)
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
HSD3B1 Antibody
(FDO66Q)
NB110-78644
Immunohistochemistry: HSD3B1 Antibody (FDO66Q) [NB110-78644] - Staining of placental villi.
(11 Publications)
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Angiogenin [HRP]
DAN00
(23 Publications)
Species: Hu
Applications: ELISA
Cytochrome P450
3A4 Antibody (3H8) - ...
NBP2-37502
ELISA: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Analysis using CYP3A4 mAb against human CYP3A4 (AA: 243-430) recombinant protein. (Expected MW is 47.5 kDa)
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Analysis using CYP3A4 mAb against HEK293 (1) and CYP3A4 (AA: 243-430)-hIgGFc transfected HEK293 (2) cell lysate.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CYP11B1 Antibody
H00001584-D01P
CYP11B1 Antibody
Species: Hu
Applications: WB

Publications for CYP11B1 Antibody (H00001584-D01P) (0)

There are no publications for CYP11B1 Antibody (H00001584-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11B1 Antibody (H00001584-D01P) (0)

There are no reviews for CYP11B1 Antibody (H00001584-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP11B1 Antibody (H00001584-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11B1 Products

Bioinformatics Tool for CYP11B1 Antibody (H00001584-D01P)

Discover related pathways, diseases and genes to CYP11B1 Antibody (H00001584-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11B1 Antibody (H00001584-D01P)

Discover more about diseases related to CYP11B1 Antibody (H00001584-D01P).
 

Pathways for CYP11B1 Antibody (H00001584-D01P)

View related products by pathway.

PTMs for CYP11B1 Antibody (H00001584-D01P)

Learn more about PTMs related to CYP11B1 Antibody (H00001584-D01P).
 

Research Areas for CYP11B1 Antibody (H00001584-D01P)

Find related products by research area.

Blogs on CYP11B1

There are no specific blogs for CYP11B1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11B1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CYP11B1
Entrez
Uniprot