Home » CYP11B1 » CYP11B1 Antibodies » CYP11B1 Antibody

CYP11B1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CYP11B1 Antibody [H00001584-D01P] - Analysis of CYP11B1 expression in transfected 293T cell line by CYP11B1 polyclonal antibody.Lane 1: CYP11B1 transfected lysate(65.10 KDa).Lane 2: Non-transfected lysate.
Western Blot: CYP11B1 Antibody [H00001584-D01P] - Analysis of CYP11B1 expression in transfected 293T cell line by CYP11B1 polyclonal antibody.Lane 1: CYP11B1 transfected lysate(65.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CYP11B1 Antibody Summary

Immunogen
CYP11B1 (AAH96285.1, 1 a.a. - 574 a.a.) full-length human protein. MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLWRCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHSGCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
Specificity
Reacts with cytochrome P450, family 11, subfamily B, polypeptide 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP11B1 Antibody

  • CPN1
  • CYPXIB1
  • cytochrome P450 11B1, mitochondrial
  • cytochrome p450 XIB1
  • cytochrome P450, family 11, subfamily B, polypeptide 1
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1
  • Cytochrome P450C11
  • Cytochrome P-450c11
  • EC 1.14.15
  • EC 1.14.15.4
  • FHICYP11B
  • FLJ36771
  • P450C11DKFZp686B05283
  • S11BH
  • Steroid 11-beta-hydroxylase
  • steroid 11-beta-monooxygenase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CYP11B2 Antibody
NBP2-13891
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of adrenal gland shows strong cytoplasmic positivity in cortical cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Western blot analysis of POMC using NB100-1533 at 0.01ug/ml in NIH 3T3 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Analysis in human Anterior Pituitary Gland shows vesilulate staining in glandular cells.
(7 Publications)
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
CYP21A2 Antibody
NBP2-38698
Western Blot: CYP21A2 Antibody [NBP2-38698] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Adrenal Gland tissue
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining in human adrenal gland and pancreas tissues using anti-CYP21A2 antibody. Corresponding CYP21A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-38698] - Staining of human adrenal gland shows high expression.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
CYP11A1 Antibody
NBP1-54758
Western Blot: CYP11A1 Antibody [NBP1-54758] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa
Immunohistochemistry: CYP11A1 Antibody [NBP1-54758] - Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody
Western Blot: CYP11A1 Antibody [NBP1-54758] - CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P

SF-1/NR5A1/Steroidogen ...
PP-N1665-00
SF-1/NR5A1/Steroidogenic Factor 1 Antibody (N1665)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IHC, IP
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Western Blot: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 17A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 17A1.
Immunohistochemistry-Paraffin: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Staining of paraffin-embedded Human tonsil using anti-Cytochrome P450 17A1 mouse monoclonal antibody.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Jurkat cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, IP, Neut
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Immunocytochemistry/Immunofluorescence: Aromatase Antibody [NB100-1596] - Aromatase antibody was tested in SH-SY-5Y cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(5 Publications)
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
StAR Antibody
NBP1-33485
Western Blot: StAR Antibody [NBP1-33485] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with StAR antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody
Immunocytochemistry/Immunofluorescence: StAR Antibody [NBP1-33485] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: StAR protein stained by StAR antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-33485] - Paraffin-embedded hepatoma. StAR antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Melanocortin-2
R/MC2R Overexpression ...
NBP2-04160
Western Blot: MC2 Receptor Overexpression Lysate (Adult Normal) [NBP2-04160] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for MC2 Receptor.
(1 Review)
Species: Hu
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and pancreas tissues using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Western Blot: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Analysis of Mineralocorticoid Receptor.
Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Mineralocorticoid Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mineralocorticoid Receptor at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
Beta
Hydroxysteroid Dehydr ...
NBP1-32353
Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-32353] - Sample(30 ug of whole cell lysate)A:HeLa S3 (GTX14654)B:MOLT4(GTX27912)12% SDS PAGE, antibody diluted at 1:500.
Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-32353] - Paraffin-embedded normal liver; antibody dilution 1:500.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
LRH-1/NR5A2
Antibody
NBP2-27196
Western Blot: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2 in HEPG2 lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse NIH3T3 and 4) RAW lysate probed with 3 ug/ml of NR5A2 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2/LRH1 in human pancreas tissue using NR5A2/LRH1 antibody at 5 ug/ml.
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Pm
Applications: WB, IHC-P
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in U251 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(2 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
HSD3B1 Antibody
(FDO66Q)
NB110-78644
Immunohistochemistry: HSD3B1 Antibody (FDO66Q) [NB110-78644] - Staining of placental villi.
(4 Publications)
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Cytochrome P450
3A4 Antibody (3H8)
NBP2-37502
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Western blot analysis using CYP3A4 mAb against HEK293 (1) and CYP3A4 (AA: 243-430)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Immunofluorescence analysis of HepG2 cells using CYP3A4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Immunohistochemical analysis of paraffin-embedded human brain tissues using CYP3A4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for CYP11B1 Antibody (H00001584-D01P) (0)

There are no publications for CYP11B1 Antibody (H00001584-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11B1 Antibody (H00001584-D01P) (0)

There are no reviews for CYP11B1 Antibody (H00001584-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP11B1 Antibody (H00001584-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11B1 Products

Bioinformatics Tool for CYP11B1 Antibody (H00001584-D01P)

Discover related pathways, diseases and genes to CYP11B1 Antibody (H00001584-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11B1 Antibody (H00001584-D01P)

Discover more about diseases related to CYP11B1 Antibody (H00001584-D01P).
 

Pathways for CYP11B1 Antibody (H00001584-D01P)

View related products by pathway.

PTMs for CYP11B1 Antibody (H00001584-D01P)

Learn more about PTMs related to CYP11B1 Antibody (H00001584-D01P).
 

Research Areas for CYP11B1 Antibody (H00001584-D01P)

Find related products by research area.

Blogs on CYP11B1

There are no specific blogs for CYP11B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11B1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CYP11B1
Entrez
Uniprot