CCL19/MIP-3 beta Antibody

Images

 
Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody [NBP2-56275] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody [NBP2-56275] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody [NBP2-56275] - Staining in human tonsil and cerebral cortex tissues using anti-CCL19 antibody. Corresponding CCL19 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CCL19/MIP-3 beta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Specificity
Specificity of human CCL19/MIP-3 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCL19
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCL19/MIP-3 beta Antibody

  • beta chemokine exodus-3
  • Beta-chemokine exodus-3
  • CC chemokine ligand 19
  • C-C motif chemokine 19
  • CCL19
  • chemokine (C-C motif) ligand 19
  • CKb11
  • EBI1-ligand chemokine
  • ELC
  • ELCMIP-3-beta
  • Epstein-Barr virus-induced molecule 1 ligand chemokine
  • exodus-3
  • Macrophage inflammatory protein 3 beta
  • macrophage inflammatory protein 3-beta
  • MGC34433
  • MIP3 beta
  • MIP-3 beta
  • MIP-3b
  • MIP3BCK beta-11
  • SCYA19EBI1 ligand chemokine
  • small inducible cytokine subfamily A (Cys-Cys), member 19
  • Small-inducible cytokine A19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB197
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut

Publications for CCL19/MIP-3 beta Antibody (NBP2-56275) (0)

There are no publications for CCL19/MIP-3 beta Antibody (NBP2-56275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL19/MIP-3 beta Antibody (NBP2-56275) (0)

There are no reviews for CCL19/MIP-3 beta Antibody (NBP2-56275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCL19/MIP-3 beta Antibody (NBP2-56275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCL19/MIP-3 beta Products

Bioinformatics Tool for CCL19/MIP-3 beta Antibody (NBP2-56275)

Discover related pathways, diseases and genes to CCL19/MIP-3 beta Antibody (NBP2-56275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL19/MIP-3 beta Antibody (NBP2-56275)

Discover more about diseases related to CCL19/MIP-3 beta Antibody (NBP2-56275).
 

Pathways for CCL19/MIP-3 beta Antibody (NBP2-56275)

View related products by pathway.

PTMs for CCL19/MIP-3 beta Antibody (NBP2-56275)

Learn more about PTMs related to CCL19/MIP-3 beta Antibody (NBP2-56275).

Blogs on CCL19/MIP-3 beta

There are no specific blogs for CCL19/MIP-3 beta, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL19/MIP-3 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL19