CCL19/MIP-3 beta Antibody - BSA Free

Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody [NBP2-56275] - Staining in human tonsil and cerebral cortex tissues using anti-CCL19 antibody. Corresponding CCL19 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody [NBP2-56275] - Staining of human tonsil shows high expression.

Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody [NBP2-56275] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCL19/MIP-3 beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCL19/MIP-3 beta Antibody - BSA Free

• beta chemokine exodus-3
• Beta-chemokine exodus-3
• CC chemokine ligand 19
• C-C motif chemokine 19
• CCL19
• chemokine (C-C motif) ligand 19
• CKb11
• EBI1-ligand chemokine
• ELC
• ELCMIP-3-beta
• Epstein-Barr virus-induced molecule 1 ligand chemokine
• exodus-3
• Macrophage inflammatory protein 3 beta
• macrophage inflammatory protein 3-beta
• MGC34433
• MIP3 beta
• MIP-3 beta
• MIP-3b
• MIP3BCK beta-11
• SCYA19EBI1 ligand chemokine
• small inducible cytokine subfamily A (Cys-Cys), member 19
• Small-inducible cytokine A19

Background

Macrophage Inflammatory Protein 3 beta is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCL19/MIP-3 beta Antibody (NBP2-56275)(1)

Publication using NBP2-56275

• Cuevas VD, SimOn-Fuentes M, Orta-Zavalza E Et al. The Gene Signature of Activated M-CSF-Primed Human Monocyte-Derived Macrophages Is IL-10-Dependent Journal of innate immunity 2021-10-20 [PMID: 34670213] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CCL19