Capicua Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: Capicua Antibody [NBP2-56342] - Staining of human cell line A549 shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Capicua Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Capicua Antibody - BSA Free (NBP2-56342) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHERP
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Capicua Recombinant Protein Antigen (NBP2-56342PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Capicua Antibody - BSA Free

  • capicua homolog (Drosophila)
  • KIAA0306capicua (Drosophila) homolog
  • protein capicua homolog

Background

CIC, a human homolog of Drosophila capicua, encodes a high mobility group box transcription factor and is fused to a double homeodomain gene DUX4 as a result of a recurrent chromosomal translocation. It is involved in epidermal growth factor receptor (EGFR) signaling, developmental patterning, and cell fate. In humans, CIC may be involved in granule cell lineage, cerebellar development, and medulloblastoma tumorigenesis. Recent evidence indicates that CIC is involved in Spinocerebellar Ataxia Type 1 (SCA-1) where it interacts directly with the product of the SCA-1 gene Ataxin-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP3-12295
Species: Hu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
DY1707
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
202-IL
Species: Hu
Applications: BA
AF5739
Species: Hu, Mu, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-89985
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Capicua Antibody (NBP2-56342) (0)

There are no publications for Capicua Antibody (NBP2-56342).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Capicua Antibody (NBP2-56342) (0)

There are no reviews for Capicua Antibody (NBP2-56342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Capicua Antibody (NBP2-56342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Capicua Products

Research Areas for Capicua Antibody (NBP2-56342)

Find related products by research area.

Blogs on Capicua

There are no specific blogs for Capicua, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Capicua Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CIC