Complement Factor B Antibody

Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human placenta shows strong positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human testis shows moderate positivity of secretion surrounding Leydig cells.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.

Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

Western blot analysis in human plasma.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Complement Factor B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CFB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. IHC-Fr reported in literature (PMID: 26928779). ICC/IF reported in literature (PMID: 30220554).
• Control Peptide:

  Complement Factor B Recombinant Protein Antigen (NBP1-89985PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:30220554) and (PMID: 26928779).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Complement Factor B Antibody

• BF AHUS4
• BF
• B-factor, properdin
• BFD
• C3 proaccelerator
• C3 proactivator
• C3/C5 convertase
• CFAB
• CFB
• Complement Factor B
• EC 3.4.21
• EC 3.4.21.47
• FB
• FBI12
• GBG
• GBGCFAB
• Glycine-rich beta glycoprotein
• glycine-rich beta-glycoprotein
• H2-Bf
• PBF2
• Properdin factor B

Background

Complement factor B is a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease that associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Complement Factor B Antibody (NBP1-89985)(7)

Publications using NBP1-89985

• Chen K, Deng Y, Shang S et al. Complement factor B inhibitor LNP023 improves lupus nephritis in MRL/lpr mice Biomedicine & Pharmacotherapy 2022-09-01 [PMID: 36076550] (IHC-P, WB, Mouse)
• Kendall RT, Renaud L, Baatz JE et al. SSc biomarkers detection in the secretome of TGFbeta1-activated primary human lung fibroblasts Journal of proteomics 2021-04-27 [PMID: 33930553]
• Lin CM, Titchenell PM, Keil JM et al. Inhibition of Atypical Protein Kinase C Reduces Inflammation-Induced Retinal Vascular Permeability. Am. J. Pathol. 2018-10-01 [PMID: 30220554] (ICC/IF, Rat)
• Yamanaka K, Kakuta Y, Miyagawa S et al. Depression of Complement Regulatory Factors in Rat and Human Renal Grafts Is Associated with the Progress of Acute T-Cell Mediated Rejection PLoS ONE 2016-03-01 [PMID: 26928779] (IHC-Fr, Rat)
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]
• Cima I, Schiess R, Wild P et al. Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer. Proc Natl Acad Sci U S A 2011-02-22 [PMID: 21300890]
• Singh MV, Kapoun A, Higgins L et al. Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart. J Clin Invest 2009-04-01 [PMID: 19273909]

Bioinformatics

• Gene Symbol: CFB