New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » Complement Factor B » Complement Factor B Antibodies » Complement Factor B Antibody

Complement Factor B Antibody

 (6 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human placenta shows strong positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human testis shows moderate positivity of secretion surrounding Leydig cells.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.
Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Complement Factor B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. IHC-Fr reported in literature (PMID: 26928779). ICC/IF reported in literature (PMID: 30220554).
Control Peptide
Complement Factor B Recombinant Protein Antigen (NBP1-89985PEP)
Publications
Read Publications using
NBP1-89985 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:30220554) and (PMID: 26928779).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor B Antibody

  • BF AHUS4
  • BF
  • B-factor, properdin
  • BFD
  • C3 proaccelerator
  • C3 proactivator
  • C3/C5 convertase
  • CFAB
  • CFB
  • Complement Factor B
  • EC 3.4.21
  • EC 3.4.21.47
  • FB
  • FBI12
  • GBG
  • GBGCFAB
  • Glycine-rich beta glycoprotein
  • glycine-rich beta-glycoprotein
  • H2-Bf
  • PBF2
  • Properdin factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry: Complement C3 Antibody (11H9) [NB200-540] - Left panel: FMO, Middle panel: No primary antibody control, Right panel: sample. Day 6 murine mammary tumors processed and stained for analysis with flow cytometry. The C3b+ population of CD45+ cells is what the gate in each sample is exhibiting. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse lymph node using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. This representative photomicrograph shows a membrane-cytoplasmic immunopositivity in non-germinal center cells, and few cells developed an intense staining for this target protein.
(2 Reviews)
(18 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(4 Reviews)
(1 Publication)
Species: Hu
Applications: IP, WB
Complement C4a/b
Antibody (JM88-13)
NBP2-66995
Immunocytochemistry/Immunofluorescence: Complement C4a/b Antibody (JM88-13) [NBP2-66995] - Staining C4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Complement C4a/b Antibody (JM88-13) [NBP2-66995] - Analysis of paraffin-embedded human liver cancer tissue using anti-C4 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Complement C4a/b Antibody (JM88-13) [NBP2-66995] - Analysis of paraffin-embedded human liver tissue using anti-C4 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Complement Factor
H Antibody [Unconjuga ...
AF4779
Complement Factor H was detected in immersion fixed paraffin-embedded sections of human liver using Goat Anti-Human Complement Factor H Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4779) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, WB
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Complement C4
Antibody
NBP3-12295
Immunohistochemistry-Paraffin: Complement C4 Antibody [NBP3-12295] - Baboon liver. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification.
Immunohistochemistry-Paraffin: Complement C4 Antibody [NBP3-12295] - Baboon kidney. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification.
Immunohistochemistry-Paraffin: Complement C4 Antibody [NBP3-12295] - Baboon liver. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification.
Species: Hu, Pm
Applications: ELISA, IHC, IHC-P, IP, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(7 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Properdin Antibody
AF8216
Western blot shows lysates of human serum, mouse serum, and rat serum. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Properdin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8216) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Properdin at approximately 53-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
Complement
Component C5a [Biotin
DY2037
(2 Reviews)
(19 Publications)
Species: Hu
Applications: ELISA
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA: HLA B Antibody (2G7B10) [NBP2-61871] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of MCF-7 cells using HLA-B mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of Hela cells using HLA-B mouse mAb. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
HLA ABC Antibody
(W6/32) - Azide and B ...
NB100-64775
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the PE/Cy5 conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control PE-Cy5 (NBP1-43073) (blue histogram) or Anti-Human HLA-ABC PE-Cy5 (purple histogram). Cells in the lymphocyte gate were
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f
Immunohistochemistry-Frozen: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis of Mouse colon cancer tissue using HLA ABC antibody (W6/32). Primary antibody dilution was 1:100. Sample was incubated with secondary antibody in 1:300 dilution. Image from verified customer review.
(2 Reviews)
(27 Publications)
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC12 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MHC Class I Antibody (OX18) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - Major histocompatibility complex (MHC) I and II as well as Transporter associated with antigen presentation II (TAPII) were analyzed, using immunocytochemistry on rat Schwann cells (SCs). Corresponding merges are shown in the bottom rows. Treatment of SCs with IL-17 was performed at concentrations of 0.5 and 50 ng/mL. Graphs to the right show densitometry quantification. SCs showed expression of MHCI > TAPII > MHCII, which increased after IL-17 treatment. MHCI was mainly detected in the cytoplasm and the expression increased in a dose-dependent manner after IL-17 treatment, significant for 0.5 ng/mL and 50 ng/mL (**P <=0.01). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-11-63), licensed under a CC-BY licence.
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Complement Factor
D/Adipsin Antibody
AF5430
Western blot shows lysates of mouse plasma. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse Complement Factor D/Adipsin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5430) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Complement Factor D/Adipsin at approximately 45kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Review)
(5 Publications)
Species: Mu
Applications: IP, WB
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Frataxin antibody, and then analyzed by flow cytometry.
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Glyoxalase I
Antibody (Glo1a)
NBP1-19015
Simple Western: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Simple Western lane view shows a specific band for GLO1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western Blot: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - HeLa whole cell extracts.
Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Immunostaining of human retinal endothelial cells. Immunoreactivity for hGlx-1 was detected in human retinal endothelial cells stained with Glo1a mAb using anti mouse IgG Texas Red as secondary Ab. The cells were counter stained with phalloidin (green) and DAPI (blue), nuclear stain. No reactivity was detected in control cells, stained without Go1a mAb. Figure is a representative of 3 independent experiments. Photo courtesy of Dr. Nagaraj, Case Western Reserve University.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(16 Publications)
Species: Hu
Applications: ELISA
Haptoglobin
Antibody (JM10-79)
NBP2-66881
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in A549 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in Hela cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in HepG2 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Complement Factor
B Antibody
NBP1-89985
Complement Factor B Antibody
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Complement Factor B Antibody (NBP1-89985)(6)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, IHC-Fr.


Filter By Application
ICC/IF
(1)
IHC-Fr
(1)
All Applications
Filter By Species
Rat
(2)
All Species

Reviews for Complement Factor B Antibody (NBP1-89985) (0)

There are no reviews for Complement Factor B Antibody (NBP1-89985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Complement Factor B Antibody (NBP1-89985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor B Products

Bioinformatics Tool for Complement Factor B Antibody (NBP1-89985)

Discover related pathways, diseases and genes to Complement Factor B Antibody (NBP1-89985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor B Antibody (NBP1-89985)

Discover more about diseases related to Complement Factor B Antibody (NBP1-89985).
 

Pathways for Complement Factor B Antibody (NBP1-89985)

View related products by pathway.

PTMs for Complement Factor B Antibody (NBP1-89985)

Learn more about PTMs related to Complement Factor B Antibody (NBP1-89985).

Blogs on Complement Factor B

There are no specific blogs for Complement Factor B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CFB