Complement Factor B Antibody

Images

 
Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-21Lane 4: Human cell line A-431Lane 5: Human liver ...read more
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Complement Factor B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunohistochemistry retrieval recommended: HIER pH6. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
Complement Factor B Protein (NBP1-89985PEP)
Publications
Read Publications using
NBP1-89985 in the following applications:

Alternate Names for Complement Factor B Antibody

  • BF
  • B-factor, properdin
  • BFAHUS4
  • BFD
  • C3 proaccelerator
  • C3 proactivator
  • C3/C5 convertase
  • CFAB
  • CFB
  • Complement Factor B
  • EC 3.4.21
  • EC 3.4.21.47
  • FB
  • FBI12
  • GBG
  • GBGCFAB
  • Glycine-rich beta glycoprotein
  • glycine-rich beta-glycoprotein
  • H2-Bf
  • PBF2
  • Properdin factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
BAF1936
Species: Hu
Applications: WB
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF4999
Species: Mu
Applications: WB, Simple Western
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-79075
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-IC
NBP1-03286
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP

Publications for Complement Factor B Antibody (NBP1-89985)(4)

Reviews for Complement Factor B Antibody (NBP1-89985) (0)

There are no reviews for Complement Factor B Antibody (NBP1-89985). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Factor B Antibody (NBP1-89985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor B Antibody Products

Related Products by Gene

Bioinformatics Tool for Complement Factor B Antibody (NBP1-89985)

Discover related pathways, diseases and genes to Complement Factor B Antibody (NBP1-89985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor B Antibody (NBP1-89985)

Discover more about diseases related to Complement Factor B Antibody (NBP1-89985).
 

Pathways for Complement Factor B Antibody (NBP1-89985)

View related products by pathway.

PTMs for Complement Factor B Antibody (NBP1-89985)

Learn more about PTMs related to Complement Factor B Antibody (NBP1-89985).

Blogs on Complement Factor B

There are no specific blogs for Complement Factor B, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CFB
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89985 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought