Complement Factor B Antibody

Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human placenta shows strong positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human testis shows moderate positivity of secretion surrounding Leydig cells.

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.

Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Complement Factor B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CFB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. IHC-Fr reported in literature (PMID: 26928779). ICC/IF reported in literature (PMID: 30220554).
• Control Peptide:

  Complement Factor B Recombinant Protein Antigen (NBP1-89985PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:30220554) and (PMID: 26928779).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Complement Factor B Antibody

• BF AHUS4
• BF
• B-factor, properdin
• BFD
• C3 proaccelerator
• C3 proactivator
• C3/C5 convertase
• CFAB
• CFB
• Complement Factor B
• EC 3.4.21
• EC 3.4.21.47
• FB
• FBI12
• GBG
• GBGCFAB
• Glycine-rich beta glycoprotein
• glycine-rich beta-glycoprotein
• H2-Bf
• PBF2
• Properdin factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Complement Factor B Antibody (NBP1-89985)(7)

Publications using NBP1-89985

• Chen K, Deng Y, Shang S et al. Complement factor B inhibitor LNP023 improves lupus nephritis in MRL/lpr mice Biomedicine & Pharmacotherapy Sep 1 2022 [PMID: 36076550] (IHC-P, WB, Mouse)
• Kendall RT, Renaud L, Baatz JE et al. SSc biomarkers detection in the secretome of TGFbeta1-activated primary human lung fibroblasts Journal of proteomics Apr 27 2021 [PMID: 33930553]
• Lin CM, Titchenell PM, Keil JM et al. Inhibition of Atypical Protein Kinase C Reduces Inflammation-Induced Retinal Vascular Permeability. Am. J. Pathol. Oct 1 2018 [PMID: 30220554] (ICC/IF, Rat)
• Yamanaka K, Kakuta Y, Miyagawa S et al. Depression of Complement Regulatory Factors in Rat and Human Renal Grafts Is Associated with the Progress of Acute T-Cell Mediated Rejection PLoS ONE Mar 1 2016 [PMID: 26928779] (IHC-Fr, Rat)
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011 Nov [PMID: 22093360]
• Cima I, Schiess R, Wild P et al. Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer. Proc Natl Acad Sci U S A 2011 Feb [PMID: 21300890]
• Singh MV, Kapoun A, Higgins L et al. Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart. J Clin Invest 2009 Apr [PMID: 19273909]

Bioinformatics

• Gene Symbol: CFB