Complement Factor B Antibody

Images

 
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Factor B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
Immunohistochemistry retrieval recommended: HIER pH6.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Complement Factor B Protein (NBP1-89985PEP)
Publications
Read Publications using
NBP1-89985 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor B Antibody

  • BF
  • B-factor, properdin
  • BFAHUS4
  • BFD
  • C3 proaccelerator
  • C3 proactivator
  • C3/C5 convertase
  • CFAB
  • CFB
  • Complement Factor B
  • EC 3.4.21
  • EC 3.4.21.47
  • FB
  • FBI12
  • GBG
  • GBGCFAB
  • Glycine-rich beta glycoprotein
  • glycine-rich beta-glycoprotein
  • H2-Bf
  • PBF2
  • Properdin factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF1936
Species: Hu
Applications: WB, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-79075
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, Flow-IC
AF5430
Species: Mu
Applications: WB, IP
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
AF4409
Species: Mu
Applications: WB

Publications for Complement Factor B Antibody (NBP1-89985)(4)

Reviews for Complement Factor B Antibody (NBP1-89985) (0)

There are no reviews for Complement Factor B Antibody (NBP1-89985). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Factor B Antibody (NBP1-89985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor B Antibody Products

Related Products by Gene

Bioinformatics Tool for Complement Factor B Antibody (NBP1-89985)

Discover related pathways, diseases and genes to Complement Factor B Antibody (NBP1-89985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor B Antibody (NBP1-89985)

Discover more about diseases related to Complement Factor B Antibody (NBP1-89985).
 

Pathways for Complement Factor B Antibody (NBP1-89985)

View related products by pathway.

PTMs for Complement Factor B Antibody (NBP1-89985)

Learn more about PTMs related to Complement Factor B Antibody (NBP1-89985).

Blogs on Complement Factor B

There are no specific blogs for Complement Factor B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFB
Entrez
Uniprot

Customers Who Bought This Also Bought