New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Complement Factor B Antibody

Images

 
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human placenta shows strong positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human testis shows moderate positivity of secretion surrounding Leydig cells.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.
Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Factor B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. IHC-Fr reported in literature (PMID: 26928779). ICC/IF reported in literature (PMID: 30220554).
Control Peptide
Complement Factor B Recombinant Protein Antigen (NBP1-89985PEP)
Publications
Read Publications using
NBP1-89985 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:30220554) and (PMID: 26928779).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor B Antibody

  • BF AHUS4
  • BF
  • B-factor, properdin
  • BFD
  • C3 proaccelerator
  • C3 proactivator
  • C3/C5 convertase
  • CFAB
  • CFB
  • Complement Factor B
  • EC 3.4.21
  • EC 3.4.21.47
  • FB
  • FBI12
  • GBG
  • GBGCFAB
  • Glycine-rich beta glycoprotein
  • glycine-rich beta-glycoprotein
  • H2-Bf
  • PBF2
  • Properdin factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1936
Species: Hu
Applications: IP, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-12295
Species: Hu, Pm
Applications: ELISA, IHC, IHC-P, IP, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
DY2037
Species: Hu
Applications: ELISA
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5430
Species: Mu
Applications: IP, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19015
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
DKK300
Species: Hu
Applications: ELISA
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Complement Factor B Antibody (NBP1-89985)(6)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, IHC-Fr.


Filter By Application
ICC/IF
(1)
IHC-Fr
(1)
All Applications
Filter By Species
Rat
(2)
All Species

Reviews for Complement Factor B Antibody (NBP1-89985) (0)

There are no reviews for Complement Factor B Antibody (NBP1-89985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Complement Factor B Antibody (NBP1-89985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor B Products

Bioinformatics Tool for Complement Factor B Antibody (NBP1-89985)

Discover related pathways, diseases and genes to Complement Factor B Antibody (NBP1-89985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor B Antibody (NBP1-89985)

Discover more about diseases related to Complement Factor B Antibody (NBP1-89985).
 

Pathways for Complement Factor B Antibody (NBP1-89985)

View related products by pathway.

PTMs for Complement Factor B Antibody (NBP1-89985)

Learn more about PTMs related to Complement Factor B Antibody (NBP1-89985).

Blogs on Complement Factor B

There are no specific blogs for Complement Factor B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFB