Home » Complement Factor B » Complement Factor B Antibodies » Complement Factor B Antibody

Complement Factor B Antibody

 (4 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Complement Factor B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
Immunohistochemistry retrieval recommended: HIER pH6.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Complement Factor B Protein (NBP1-89985PEP)
Publications
Read Publications using
NBP1-89985 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor B Antibody

  • BF
  • B-factor, properdin
  • BFAHUS4
  • BFD
  • C3 proaccelerator
  • C3 proactivator
  • C3/C5 convertase
  • CFAB
  • CFB
  • Complement Factor B
  • EC 3.4.21
  • EC 3.4.21.47
  • FB
  • FBI12
  • GBG
  • GBGCFAB
  • Glycine-rich beta glycoprotein
  • glycine-rich beta-glycoprotein
  • H2-Bf
  • PBF2
  • Properdin factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement C3
Antibody (11H9)
NB200-540
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - IHC-P detection of Complement C3 protein in a formalin fixed paraffin embedded tissue section of mouse liver using 1 : 100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
(1 Review)
(1 Publication)
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Complement
Component C2 Antibody
AF1936
Complement Component C2 Antibody
Species: Hu
Applications: WB, IP
Complement C4a
Antibody
NBP2-14893
Western Blot: Complement C4a Antibody [NBP2-14893] - Sample (30 ug of whole cell lysate) A: HepG2; 5% SDS PAGE, antibody diluted at 1:500.
Immunohistochemistry-Paraffin: Complement C4a Antibody [NBP2-14893] - Paraffin-embedded Hepatoma, using antibody at 1:200 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
Complement Factor
H Antibody [Unconjuga ...
AF4999
Western blot shows lysates of Hepa 1‑6 mouse hepatoma cell line and mouse plasma. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse Complement Factor H Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4999) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Complement Factor H at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows mouse plasma, loaded at 0.2 mg/mL. A specific band was detected for Complement Factor H at approximately 166 kDa (as indicated) using 10 µg/mL of Sheep Anti-Mouse Complement Factor H Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4999) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Mu
Applications: WB, Simple Western
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Lane 1: Marker [kDa]. Lane 2:Human cell line U-251 MG
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U251 cell line showing distinct nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U2OS cell line with Anti-HNRNPC monoclonal antibody, showing distinct nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF, IHC
Complement C4
Antibody (A24-T)
NBP1-79075
Immunohistochemistry-Paraffin: Complement C4 Antibody (A24-T) [NBP1-79075] - Complement C4 Antibody (A24-T) Formalin-fixed and paraffin-embedded human transplanted kidney stained with anti-C4d complement antibody shows diffuse strong positive immunostaining of peritubular and glomerular capillaries (A), indicating acute antibody mediated rejection and diffuse strong positive immunostaining of dilated peritubular moderate capillaries (B), indicating acute antibody mediated rejection.
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Properdin Antibody
AF8216
Western blot shows lysates of human serum, mouse serum, and rat serum. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Properdin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8216) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Properdin at approximately 53-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
HLA B7 Antibody
NBP2-29931
Western Blot: HLA B7 Antibody [NBP2-29931] - Analysis of lysates from HL-60, Jurkat, Ramos cell line (from left to right), using HLA-B Antibody (N-term). Diluted at 1:1000 at each lane. A goat anti-rabbit IgG H&L(HRP) at 1:5000 dilution was used as the secondary antibody. Lysates at 35ug per lane.
Immunohistochemistry-Paraffin: HLA B7 Antibody [NBP2-29931] - Formalin-fixed and paraffin-embedded human hepatocarcinoma reacted with HLA-B Antibody (N-term), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Flow Cytometry: HLA B7 Antibody [NBP2-29931] - Flow cytometry analysis of HepG2 cells (bottom histogram) compared to a negative control cell (top histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
Species: Hu
Applications: WB, Flow, IHC-P
HLA ABC Antibody
(W6/32)
NB100-64775
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC.
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488.
(1 Review)
(22 Publications)
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
Flow (Intracellular): MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were stained with MHC Class I NB120-6405 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
(29 Publications)
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, Flow-IC
Complement Factor
D/Adipsin Antibody
AF5430
Western blot shows lysates of mouse plasma. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse Complement Factor D/Adipsin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5430) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Complement Factor D/Adipsin at approximately 45kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(2 Publications)
Species: Mu
Applications: WB, IP
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(1C12)
NBP2-01743
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Glyoxalase I
Antibody (Glo1a)
NBP1-19015
Western Blot: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - HeLa whole cell extracts.
Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Immunostaining of human retinal endothelial cells. Immunoreactivity for hGlx-1 was detected in human retinal endothelial cells stained with Glo1a mAb using anti mouse IgG Texas Red as secondary Ab. The cells were counter stained with phalloidin (green) and DAPI (blue), nuclear stain. No reactivity was detected in control cells, stained without Go1a mAb. Figure is a representative of 3 independent experiments. Photo courtesy of Dr. Nagaraj, Case Western Reserve University.
Simple Western: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Simple Western lane view shows a specific band for GLO1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
Kallikrein 3/PSA
Antibody (5A11E9)
NBP1-51541
Western Blot: Kallikrein 3/PSA Antibody (5A11E9) [NBP1-51541] - Analysis against truncated Prostate Specific Antigen recombinant protein.
Immunohistochemistry-Paraffin: Kallikrein 3/PSA Antibody (5A11E9) [NBP1-51541] - Analysis of paraffin-embedded human prostate carcinoma tissues, showing cytoplasmic localization using Prostate Specific Antigen mouse mAb with DAB staining.
Flow Cytometry: Kallikrein 3/PSA Antibody (5A11E9) [NBP1-51541] - Flow cytometric analysis of PC-3 cells using Prostate Specific Antigen mouse mAb (right) and negative control (left).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Haptoglobin
Antibody
AF4409
Western blot shows samples of purified mouse Haptoglobin (5 ng/lane). PVDF membrane was probed with 1 µg/mL Sheep Anti-Mouse Haptoglobin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4409) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band for Haptoglobin was detected at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Mu
Applications: WB
Complement Factor
B Antibody
NBP1-89985
Complement Factor B Antibody
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for Complement Factor B Antibody (NBP1-89985)(4)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Complement Factor B Antibody (NBP1-89985) (0)

There are no reviews for Complement Factor B Antibody (NBP1-89985). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Factor B Antibody (NBP1-89985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor B Antibody Products

Related Products by Gene

C2, C3, C4A, C4B, C5, CFD, CFH, CFP, COMPLEMENT C4, FACTOR B, FANCA, FXN, GLO1, HLA-A, HLA-B, HLA-E, HNRNPC, HP, KLK3, TNF

Bioinformatics Tool for Complement Factor B Antibody (NBP1-89985)

Discover related pathways, diseases and genes to Complement Factor B Antibody (NBP1-89985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor B Antibody (NBP1-89985)

Discover more about diseases related to Complement Factor B Antibody (NBP1-89985).
 

Pathways for Complement Factor B Antibody (NBP1-89985)

View related products by pathway.

PTMs for Complement Factor B Antibody (NBP1-89985)

Learn more about PTMs related to Complement Factor B Antibody (NBP1-89985).

Blogs on Complement Factor B

There are no specific blogs for Complement Factor B, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CFB
Entrez
Uniprot

Customers Who Bought This Also Bought