![Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Western-Blot-NBP1-89985-img0008.jpg "Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in human plasma.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG |
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CFB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunohistochemistry retrieval recommended: HIER pH6. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Complement Factor B Antibody (NBP1-89985)Discover more about diseases related to Complement Factor B Antibody (NBP1-89985).
| Pathways for Complement Factor B Antibody (NBP1-89985)View related products by pathway.
|
PTMs for Complement Factor B Antibody (NBP1-89985)Learn more about PTMs related to Complement Factor B Antibody (NBP1-89985).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89985-img0001.jpg "Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.")
![Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/Complement Factor B Antibody-Western Blot-NBP1-89985-img0009.jpg "Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Simple-Western-NBP1-89985-img0006.jpg "Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Simple-Western-NBP1-89985-img0007.jpg "Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).")
![Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).](http://images.novusbio.com/fullsize2/Complement-C3-Antibody-(11H9)-Flow-(Intracellular)-NB200-540-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern.](http://images.novusbio.com/fullsize2/Complement-C3-Antibody-(11H9)-Immunocytochemistry-Immunofluorescence-NB200-540-img0002.jpg)
![Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - IHC-P detection of Complement C3 protein in a formalin fixed paraffin embedded tissue section of mouse liver using 1 : 100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.](http://images.novusbio.com/fullsize2/Complement-C3-Antibody-(11H9)-Immunohistochemistry-Paraffin-NB200-540-img0004.jpg)
![Immunohistochemistry-Paraffin: Complement C4d Antibody (C4D204) [NBP2-34234] - Formalin-fixed, paraffin-embedded human kidney transplant tissue (20X) stained with Complement 4d MAb (C4D204).](http://images.novusbio.com/fullsize2/Complement-C4d-Antibody-(C4D204)-Immunohistochemistry-Paraffin-NBP2-34234-img0002.jpg)
![Immunohistochemistry-Paraffin: Complement C4d Antibody (C4D204) [NBP2-34234] - Formalin-fixed, paraffin-embedded human kidney transplant tissue (10X) stained with Complement 4d MAb (C4D204).](http://images.novusbio.com/fullsize2/Complement-C4d-Antibody-(C4D204)-Immunohistochemistry-Paraffin-NBP2-34234-img0001.jpg)
![Immunohistochemistry-Paraffin: Complement C4d Antibody (C4D204) [NBP2-34234] - Formalin-fixed, paraffin-embedded human kidney transplant tissue (40X) stained with Complement 4d Ab (C4D204).](http://images.novusbio.com/fullsize2/Complement C4d Antibody (C4D204)-Immunohistochemistry-Paraffin-NBP2-34234-img0003.jpg)
![Western Blot: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Lane 1: Marker [kDa]. Lane 2:Human cell line U-251 MG](http://images.novusbio.com/fullsize2/hnRNP-C1-+-C2-Antibody-(CL2593)-Western-Blot-NBP2-36776-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U251 cell line showing distinct nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/hnRNP-C1-+-C2-Antibody-(CL2593)-Immunocytochemistry-Immunofluorescence-NBP2-36776-img0012.jpg)
![Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U2OS cell line with Anti-HNRNPC monoclonal antibody, showing distinct nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/hnRNP-C1-+-C2-Antibody-(CL2593)-Immunohistochemistry-NBP2-36776-img0011.jpg)
![ELISA: Complement C4 ELISA Kit [Biotin] [KA0467] - Standard curve](http://images.novusbio.com/fullsize2/Complement-C4-ELISA-Kit-[Biotin]-ELISA-KA0467-img0001.jpg)
![Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.](http://images.novusbio.com/fullsize2/Complement-C4b-d-Antibody-(16D2)-Western-Blot-NB200-541-img0001.jpg)
![Western Blot: HLA B7 Antibody [NBP2-29931] - Analysis of lysates from HL-60, Jurkat, Ramos cell line (from left to right), using HLA-B Antibody (N-term). Diluted at 1:1000 at each lane. A goat anti-rabbit IgG H&L(HRP) at 1:5000 dilution was used as the secondary antibody. Lysates at 35ug per lane.](http://images.novusbio.com/fullsize2/HLA-B7-Antibody-Western-Blot-NBP2-29931-img0010.jpg)
![Immunohistochemistry-Paraffin: HLA B7 Antibody [NBP2-29931] - Formalin-fixed and paraffin-embedded human hepatocarcinoma reacted with HLA-B Antibody (N-term), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.](http://images.novusbio.com/fullsize2/HLA-B7-Antibody-Immunohistochemistry-Paraffin-NBP2-29931-img0002.jpg)
![Flow Cytometry: HLA B7 Antibody [NBP2-29931] - Flow cytometry analysis of HepG2 cells (bottom histogram) compared to a negative control cell (top histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.](http://images.novusbio.com/fullsize2/HLA-B7-Antibody-Flow-Cytometry-NBP2-29931-img0001.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f](http://images.novusbio.com/fullsize2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0013.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC.](http://images.novusbio.com/fullsize2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0002.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488.](http://images.novusbio.com/fullsize2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/MHC-Class-I-Antibody-(OX18)-Immunocytochemistry-Immunofluorescence-NB120-6405-img0003.jpg)
![Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).](http://images.novusbio.com/fullsize2/MHC-Class-I-Antibody-(OX18)-Flow-Cytometry-NB120-6405-img0007.jpg)
![Flow (Intracellular): MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were stained with MHC Class I NB120-6405 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.](http://images.novusbio.com/fullsize2/MHC-Class-I-Antibody-(OX18)-Flow-(Intracellular)-NB120-6405-img0004.jpg)
![Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.](http://images.novusbio.com/fullsize2/FACA-FANCA-Antibody-Western-Blot-NB100-2564-img0004.jpg)
![Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.](http://images.novusbio.com/fullsize/Frataxin Antibody (1C12)-Western Blot-NBP2-01743-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.](http://images.novusbio.com/fullsize/Frataxin Antibody (1C12)-Immunocytochemistry-Immunofluorescence-NBP2-01743-img0009.jpg)
![Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.](http://images.novusbio.com/fullsize/Frataxin Antibody (1C12)-Immunohistochemistry-Paraffin-NBP2-01743-img0008.jpg)
![Western Blot: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - HeLa whole cell extracts.](http://images.novusbio.com/fullsize2/Glyoxalase-I-Antibody-(Glo1a)-Western-Blot-NBP1-19015-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Immunostaining of human retinal endothelial cells. Immunoreactivity for hGlx-1 was detected in human retinal endothelial cells stained with Glo1a mAb using anti mouse IgG Texas Red as secondary Ab. The cells were counter stained with phalloidin (green) and DAPI (blue), nuclear stain. No reactivity was detected in control cells, stained without Go1a mAb. Figure is a representative of 3 independent experiments. Photo courtesy of Dr. Nagaraj, Case Western Reserve University.](http://images.novusbio.com/fullsize2/Glyoxalase-I-Antibody-(Glo1a)-Immunocytochemistry-Immunofluorescence-NBP1-19015-img0004.jpg)
![Simple Western: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Simple Western lane view shows a specific band for GLO1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.](http://images.novusbio.com/fullsize2/Glyoxalase-I-Antibody-(Glo1a)-Simple-Western-NBP1-19015-img0006.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")