C1q Antibody

Images

 
Western Blot: C1q Antibody [NBP1-87492] - Analysis in human spleen tissue.
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human duodenum shows strong positivity in plasma.
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human placenta shows strong positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1q Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1QA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C1q Protein (NBP1-87492PEP)
Publications
Read Publications using NBP1-87492.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1q Antibody

  • A chain
  • complement component 1, q subcomponent, A chain
  • complement component 1, q subcomponent, alpha polypeptide

Background

C1q encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C1q Antibody (NBP1-87492)(2)

Reviews for C1q Antibody (NBP1-87492) (0)

There are no reviews for C1q Antibody (NBP1-87492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1q Antibody (NBP1-87492). (Showing 1 - 1 of 1 FAQs).

  1. I am looking for polyclonal/monoclonal antibodies against canine C1q and complement-related. I was wondering if your prooduct does.
    • Please see the provided link below which will take you to our website and all of our C1Q antibodies that are available. Unfortunately we do not currently have an antibody that has been tested in dog but if that would be something you are interested in doing, I would like to invite you to review our Innovator's rewards program. Should you have any questions or concerns, please do not hesitate to contact me directly. C1Q antibodies: Innovators Rewards Program

Secondary Antibodies

 

Isotype Controls

Additional C1q Products

Research Areas for C1q Antibody (NBP1-87492)

Find related products by research area.

Blogs on C1q

There are no specific blogs for C1q, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1q Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QA