Recombinant Human c-Myc GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human c-Myc Protein [H00004609-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP, Enzyme Activity

Order Details

Recombinant Human c-Myc GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 330-439 of Human c-Myc

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MYC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Kinase Assay
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004609-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human c-Myc GST (N-Term) Protein

  • avian myelocytomatosis viral oncogene homolog
  • BHLHE39
  • bHLHe39MRTL
  • Class E basic helix-loop-helix protein 39
  • cMyc
  • c-Myc
  • myc proto-oncogene protein
  • Myc
  • Myc2
  • MYCC
  • myc-related translation/localization regulatory factor
  • Niard
  • Nird
  • Proto-oncogene c-Myc
  • Transcription factor p64
  • v-myc avian myelocytomatosis viral oncogene homolog
  • v-myc myelocytomatosis viral oncogene homolog (avian)

Background

The c-Myc protein is a transcription factor, which is encoded by the c-Myc gene on human chromosome 8q24. c-Myc is a multifunctional, nuclear phosphoprotein that functions as a transcription factor with a theoretical molecular weight of 62kDa. However, c-Myc is extremely labile and is degraded very quickly even in extracts prepared with boiling SDS sample buffer, such that a molecular weight of ~40 kDa has been observed. c-Myc is part of a heterodimeric complex with Max that acts as a potent transcriptional activator. c-Myc is modified by glycosylation and phosphorylation and has been shown to interact with numerous proteins including SMAD2, SMAD3, LSD1/KDM1A, MAD, and Sp1 (1).

A basic Helix-Loop-Helix, Leucine Zipper domain (bHLH/LZ), designated Max, specifically associates with c-Myc, N-Myc and L-Myc proteins. The Myc-Max complex binds to DNA in a sequence-specific manner under conditions where neither Max nor Myc exhibit appreciable binding. Max can also form heterodimers with other bHLH-Zip proteins, Mad and Mxi1. c-Myc plays a role in cell cycle progression, apoptosis, cellular transformation and angiogenesis (2). Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of cancers including B-cell Lymphomas, acute myeloid leukemia, glioblastoma, stomach adenocarcinoma, and prostate adenocarcinoma (3).

References

1. Wilkinson, D. S., Tsai, W. W., Schumacher, M. A., & Barton, M. C. (2008). Chromatin-bound p53 anchors activated Smads and the mSin3A corepressor to confer transforming-growth-factor-beta-mediated transcription repression. Mol Cell Biol, 28(6), 1988-1998. doi:10.1128/mcb.01442-07

2. Pedrosa, A. R., Bodrug, N., Gomez-Escudero, J., Carter, E. P., Reynolds, L. E., Georgiou, P. N., . . . Hodivala-Dilke, K. M. (2019). Tumor Angiogenesis Is Differentially Regulated by Phosphorylation of Endothelial Cell Focal Adhesion Kinase Tyrosines-397 and -861. Cancer Res, 79(17), 4371-4386. doi:10.1158/0008-5472.Can-18-3934

3. Nagasaka, M., Tsuzuki, K., Ozeki, Y., Tokugawa, M., Ohoka, N., Inoue, Y., & Hayashi, H. (2019). Lysine-Specific Demethylase 1 (LSD1/KDM1A) Is a Novel Target Gene of c-Myc. Biol Pharm Bull, 42(3), 481-488. doi:10.1248/bpb.b18-00892

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-793
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
236-EG
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
H00004609-Q01
Species: Hu
Applications: WB, ELISA, MA, AP, Enzyme Activity

Publications for c-Myc Recombinant Protein (H00004609-Q01)(1)

Reviews for c-Myc Recombinant Protein (H00004609-Q01) (0)

There are no reviews for c-Myc Recombinant Protein (H00004609-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for c-Myc Recombinant Protein (H00004609-Q01). (Showing 1 - 1 of 1 FAQ).

  1. What is the degree of purity for the 3 products H00004609-P01, H00004602-P01, and H00004609-Q01?Fragment-->
    • All of these proteins are produced in Host: Wheat Germ (in vitro), Preparation Method:in vitro wheat germ expression system, Purification:Glutathione Sepharose 4 Fast Flow.

Additional c-Myc Products

Research Areas for c-Myc Recombinant Protein (H00004609-Q01)

Find related products by research area.

Blogs on c-Myc. Showing 1-10 of 15 blog posts - Show all blog posts.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

The role of c-Fos in the regulation of the JC virus gene transcription
c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B.  Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D.  Each member of the AP-1 transcri...  Read full blog post.

Dual applications of a c-Myc antibody in mitochondrial research
c-Myc, a proto-oncogene, has documented involvement in cellular differentiation, cell growth, cell death and tumor formation.  Target genes of the Myc family include those that participate in cell survival, translation, transcription, metabolism and...  Read full blog post.

MAPK8/JNK1 - A multifunctional kinase and drug target for cancer therapeutics
The c-Jun N-terminal kinase (JNK) family is a group of regulatory kinases with important functions in cell morphogenesis, inflammation, differentiation, and cell death (1). Aberrant activation of JNK family proteins in cancers has led to interest i...  Read full blog post.

MYC - A human oncogene with valuable laboratory applications
Myc is a basic helix-loop-helix zipper transcription factor that regulates a network of many hundreds of genes. Myc up-regulates the expression of many genes involved in cell growth and proliferation such as ribosome biogenesis and protein synthesi...  Read full blog post.

c-Myc - transcription factor and oncogene
c-Myc is a protein of the Myc family of transcription factors (c-Myc, B-Myc, L-Myc, N-Myc, and s-Myc) encoded by the MYC proto-oncogene. c-Myc was first discovered as the cellular homolog of the retroviral v-Myc oncogene. c-Myc is a transcription ...  Read full blog post.

c-Myc. See Myc Run Transcription Regulation
Myc genes (L-Myc, N-Myc and C-Myc) are a family of transcription factors. c-Myc is involved in transcription regulation, apoptosis and cell growth. Mutations in c-Myc have been tied to several cancers. Free sample bonus: Get a free sample on ...  Read full blog post.

Beta Catenin Implications for Signaling
The Wnt/beta Catenin signaling pathway plays a critical role in embryonic development, stem cell self-renewal and regeneration. Alterations in this signaling cascade have been implicated in the pathogenesis of cancer. Notably, chronic activation of Wn...  Read full blog post.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

CIP2A: The Cancerous Inhibitor of Protein Phosphatase 2A
The autoantigen p90 is a recently discovered protein that binds to and inhibits Protein Phosphatase 2A (PP2A) activity, thereby playing a critical role in cancer progression. Thus, p90 was renamed the "cancerous inhibitory protein of PP2A" or CIP2A....  Read full blog post.

Showing 1-10 of 15 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human c-Myc GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYC