BMP-2 Antibody


Western Blot: BMP-2 Antibody [NBP2-56251] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: BMP-2 Antibody [NBP2-56251] - Staining of human cell line RT4 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

BMP-2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS
Specificity of human BMP-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BMP-2 Recombinant Protein Antigen (NBP2-56251PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for BMP-2 Antibody

  • BDA2
  • BMP2
  • BMP-2
  • BMP-2A
  • BMP2ABone morphogenetic protein 2A
  • bone morphogenetic protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)

Publications for BMP-2 Antibody (NBP2-56251) (0)

There are no publications for BMP-2 Antibody (NBP2-56251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-2 Antibody (NBP2-56251) (0)

There are no reviews for BMP-2 Antibody (NBP2-56251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BMP-2 Antibody (NBP2-56251). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in Bone Morphogenic Protein 2 (BMP-2) for clinical trial in humans. I am using this protein in stem cells culture for future use in humans. Do you have BMP-2 in pharma grade that I can use for humans?
    • Our antibodies are for research purposes only unfortunately. I am sorry we cannot be of further help.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional BMP-2 Products

Bioinformatics Tool for BMP-2 Antibody (NBP2-56251)

Discover related pathways, diseases and genes to BMP-2 Antibody (NBP2-56251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-2 Antibody (NBP2-56251)

Discover more about diseases related to BMP-2 Antibody (NBP2-56251).

Pathways for BMP-2 Antibody (NBP2-56251)

View related products by pathway.

PTMs for BMP-2 Antibody (NBP2-56251)

Learn more about PTMs related to BMP-2 Antibody (NBP2-56251).

Research Areas for BMP-2 Antibody (NBP2-56251)

Find related products by research area.

Blogs on BMP-2

There are no specific blogs for BMP-2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BMP-2 Antibody and receive a gift card or discount.


Gene Symbol BMP2