ASRGL1 Antibody

Images

 
Western Blot: ASRGL1 Antibody [NBP1-89133] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ASRGL1 Antibody [NBP1-89133] - Staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP1-89133 (A) ...read more
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human testis shows moderate positivity in a subset cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding ASRGL1 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASRGL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASRGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASRGL1 Protein (NBP1-89133PEP)
Publications
Read Publication using
NBP1-89133 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25858696).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASRGL1 Antibody

  • ALP1
  • ALPL-asparagine amidohydrolase
  • asparaginase like 1
  • asparaginase-like 1 protein
  • Asparaginase-like protein 1
  • CRASH
  • EC 3.5.1.1
  • FLJ22316
  • L-asparaginase

Background

ASRGL1 acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as anexcitatory neurotransmitter in some brain regions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASRGL1 Antibody (NBP1-89133)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ASRGL1 Antibody (NBP1-89133) (0)

There are no reviews for ASRGL1 Antibody (NBP1-89133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASRGL1 Antibody (NBP1-89133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASRGL1 Products

Research Areas for ASRGL1 Antibody (NBP1-89133)

Find related products by research area.

Blogs on ASRGL1

There are no specific blogs for ASRGL1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASRGL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASRGL1