ASRGL1 Antibody

Western Blot: ASRGL1 Antibody [NBP1-89133] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ASRGL1 Antibody [NBP1-89133] - Staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP1-89133 (A) shows similar protein distribution across tissues to independent antibody NBP2-38759 (B).

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human testis shows moderate positivity in a subset cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding ASRGL1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ASRGL1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASRGL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ASRGL1 Protein (NBP1-89133PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25858696).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ASRGL1 Antibody

• ALP1
• ALPL-asparagine amidohydrolase
• asparaginase like 1
• asparaginase-like 1 protein
• Asparaginase-like protein 1
• CRASH
• EC 3.5.1.1
• FLJ22316
• L-asparaginase

Background

ASRGL1 acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as anexcitatory neurotransmitter in some brain regions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASRGL1 Antibody (NBP1-89133)(1)

Publication using NBP1-89133

• Edqvist PH, Huvila J, Forsstrom B et al. Loss of ASRGL1 expression is an independent biomarker for disease-specific survival in endometrioid endometrial carcinoma. Gynecol Oncol 2015-04-07 [PMID: 25858696] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: ASRGL1