ASRGL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ASRGL1 Antibody [NBP1-89133] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human corpus, uterine shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASRGL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASRGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASRGL1 Protein (NBP1-89133PEP)
Publications
Read Publication using
NBP1-89133 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25858696).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASRGL1 Antibody

  • ALP1
  • ALPL-asparagine amidohydrolase
  • asparaginase like 1
  • asparaginase-like 1 protein
  • Asparaginase-like protein 1
  • CRASH
  • EC 3.5.1.1
  • FLJ22316
  • L-asparaginase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-35213
Species: Hu
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P

Publications for ASRGL1 Antibody (NBP1-89133)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ASRGL1 Antibody (NBP1-89133) (0)

There are no reviews for ASRGL1 Antibody (NBP1-89133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASRGL1 Antibody (NBP1-89133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASRGL1 Products

Bioinformatics Tool for ASRGL1 Antibody (NBP1-89133)

Discover related pathways, diseases and genes to ASRGL1 Antibody (NBP1-89133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASRGL1 Antibody (NBP1-89133)

Discover more about diseases related to ASRGL1 Antibody (NBP1-89133).
 

Pathways for ASRGL1 Antibody (NBP1-89133)

View related products by pathway.

PTMs for ASRGL1 Antibody (NBP1-89133)

Learn more about PTMs related to ASRGL1 Antibody (NBP1-89133).

Blogs on ASRGL1

There are no specific blogs for ASRGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASRGL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASRGL1