NAT10 Antibody (5Z3E5)

Western Blot: NAT10 Antibody (5Z3E5) [NBP3-15742] - Analysis of extracts of Mouse testis, using NAT10 antibody (NBP3-15742) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry: NAT10 Antibody (5Z3E5) [NAT10] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using NAT10 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: NAT10 Antibody (5Z3E5) [NAT10] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using NAT10 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: NAT10 Antibody (5Z3E5) [NAT10] - Immunohistochemistry analysis of paraffin-embedded Human colon using NAT10 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: NAT10 Antibody (5Z3E5) [NAT10] - Western blot analysis of various lysates using NAT10 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.

Immunohistochemistry: NAT10 Antibody (5Z3E5) [NAT10] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using NAT10 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: NAT10 Antibody (5Z3E5) [NAT10] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using NAT10 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: NAT10 Antibody (5Z3E5) [NAT10] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using NAT10 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 5Z3E5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

NAT10 Antibody (5Z3E5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 750-1025 of human NAT10 (Q9H0A0). KTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NAT10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NAT10 Antibody (5Z3E5)

• ALP
• DKFZp434C116
• EC 2.3.1.-
• FLJ10774
• FLJ12179
• FLJ23850
• hALP
• KIAA1709
• N-acetyltransferase 10 (GCN5-related)
• N-acetyltransferase 10
• N-acetyltransferase-like protein
• NAT10
• NET43

Background

NAT10 has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT10