Als2 Antibody


Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Als2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSY LALVDKNIMGYIASLHELATTERRFYSKLSD
Specificity of human Als2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Brain Cerebellum Lysate (NB820-59396)
Control Peptide
Als2 Protein (NBP2-14284PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Als2 Antibody

  • ALS2CR6
  • alsin
  • ALSJ
  • amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 6
  • amyotrophic lateral sclerosis 2 (juvenile)
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 6 protein
  • Amyotrophic lateral sclerosis 2 protein
  • FLJ31851
  • KIAA1563
  • MGC87187
  • PLSJ


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC

Publications for Als2 Antibody (NBP2-14284) (0)

There are no publications for Als2 Antibody (NBP2-14284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Als2 Antibody (NBP2-14284) (0)

There are no reviews for Als2 Antibody (NBP2-14284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Als2 Antibody (NBP2-14284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Als2 Products

Bioinformatics Tool for Als2 Antibody (NBP2-14284)

Discover related pathways, diseases and genes to Als2 Antibody (NBP2-14284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Als2 Antibody (NBP2-14284)

Discover more about diseases related to Als2 Antibody (NBP2-14284).

Pathways for Als2 Antibody (NBP2-14284)

View related products by pathway.

PTMs for Als2 Antibody (NBP2-14284)

Learn more about PTMs related to Als2 Antibody (NBP2-14284).

Blogs on Als2.

Amyotrophic Lateral Sclerosis Infographic
Amyotrophic lateral sclerosis is a neurological disease which impacts motor neurons that are involved in muscle movement throughout the body. The progressive degeneration of neurons causes weakened muscles and can lead to paralysis. There is no cure f...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Als2 Antibody and receive a gift card or discount.


Gene Symbol ALS2