Als2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 uM H2O2 and 5 uM CellEvent caspase-3/7 green detection reagent at 37 degrees C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/32282), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Staining of human cell line U-2 OS shows localization to intermediate filaments. Antibody staining is shown in green.

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 μM H2O2 & 5 μM CellEvent caspase-3/7 green detection reagent at 37°C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Error bars represent SEMs. Scale bars, 10 μm.10.7554/eLife.32282.045Figure 10—figure supplement 2—source data 1.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Validation of the CRISPR/Cas9 Alsin-/- cells in iPSC, NPC & iPSC-sMN.(A) Electrophoresis result of the PCR reaction using primers flanking exon three & within exon 3. Homozygous deletion was confirmed by the absence of a 2.8 kb. (B) Protein lysates from WT KOLF & Alsin-/- iPSC were loaded onto SDS-PAGE & immunoblotted with Alsin antibody. A band detected at ~184 kDa, but absent in Alsin-/-, corresponds to full-length Alsin. (C) WT KOLF, Alsin-/- iPSC, & neuroprogenitor cells (NPC) were immunostained with pluripotency markers Oct4 & Lin28, & neuroprogenitor markers Sox2 & Pax6, respectively. (D–E) WT KOLF & Alsin-/- iPSC-sMN were immunostained with motor neuron markers such as ChAT, HB9, & ISL1, nuclear dye DAPI, & cytoskeletal marker MAP2. (F) WT KOLF & Alsin-/- iPSC-sMN were immunostained with antibodies against Rab5 & Alsin, along with DAPI (nuclear) & phalloidin (actin) stains. Scale bars, 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Als2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Als2 Antibody - BSA Free (NBP2-14284) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Als2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control:

  Human Brain Cerebellum Whole Tissue Lysate (Adult Whole Multiple Sclerosis)

• Control Peptide:

  Als2 Protein (NBP2-14284PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Als2 Antibody - BSA Free

• ALS2CR6
• alsin
• ALSJ
• amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 6
• amyotrophic lateral sclerosis 2 (juvenile)
• Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 6 protein
• Amyotrophic lateral sclerosis 2 protein
• FLJ31851
• IAHSP
• KIAA1563
• MGC87187
• PLSJ

Background

Defects in ALS2, or Alsin, are the cause of amyotrophic lateral sclerosis 2 (ALS2), juvenile primary lateral sclerosis (JPLS), and infantile-onset ascending spastic paralysis (IAHSP). ALS2 is a neurodegenerative disorder which is closely related to but clinically distinct from juvenile primary lateral sclerosis. It is a progressive paralytic disorder which results from dysfunction of the motor systems comprising the upper motor neurons of the motor cortex and lower motor neurons of the brain stem and spinal cord. JPLS is a neurodegenerative disorder which is closely related to but clinically distinct from amyotrophic lateral sclerosis. It is a progressive paralytic disorder which results from dysfunction of the upper motor neurons of the motor cortex while the lower neurons are unaffected. IAHSP is characterized by progressive spasticity and weakness of limbs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Als2 Antibody (NBP2-14284)(1)

Publication using NBP2-14284

• Hsu F, Spannl S, Ferguson C et al. Rab5 and Alsin regulate stress-activated cytoprotective signaling on mitochondria. bioRxiv. [PMID: 29469808] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: ALS2