ALS2CL Antibody

Images

 
Western Blot: ALS2CL Antibody [NBP2-30434] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ALS2CL Antibody [NBP2-30434] - Staining of human breast shows strong cytoplasmic positivity in glandular and myoepithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALS2CL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALS2CL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALS2CL Protein (NBP2-30434PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALS2CL Antibody

  • ALS2 C-terminal like
  • ALS2 C-terminal-like protein
  • DKFZp686I0110
  • DKFZp686P238
  • FLJ36525
  • MGC129698
  • RN49018

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-885
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12421
Species: Hu
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85032
Species: Hu
Applications: ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP1-82145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
7570-GH
Species: Hu
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-30434
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ALS2CL Antibody (NBP2-30434) (0)

There are no publications for ALS2CL Antibody (NBP2-30434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALS2CL Antibody (NBP2-30434) (0)

There are no reviews for ALS2CL Antibody (NBP2-30434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALS2CL Antibody (NBP2-30434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALS2CL Products

Bioinformatics Tool for ALS2CL Antibody (NBP2-30434)

Discover related pathways, diseases and genes to ALS2CL Antibody (NBP2-30434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALS2CL Antibody (NBP2-30434)

Discover more about diseases related to ALS2CL Antibody (NBP2-30434).
 

Pathways for ALS2CL Antibody (NBP2-30434)

View related products by pathway.

Blogs on ALS2CL

There are no specific blogs for ALS2CL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALS2CL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALS2CL
Uniprot