RCC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RCC1 Antibody [NBP1-85638] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Staining of human cerebral cortex shows very weak nuclear positivity in neurons.

Staining of human rectum shows strong nuclear positivity in glandular cells.

Staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.

Analysis in human testis and cerebral cortex tissues using HPA027573 antibody. Corresponding RCC1 RNA-seq data are presented for the same tissues.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Analysis using Anti-RCC1 antibody NBP1-85638 (A) shows similar pattern to independent antibody NBP1-85637 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RCC1 Antibody - BSA Free (NBP1-85638) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RCC1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RCC1 Protein (NBP1-85638PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RCC1 Antibody - BSA Free

• Cell cycle regulatory protein
• CHC1RCC1-I
• chromosome condensation 1
• Chromosome condensation protein 1
• guanine nucleotide-releasing protein
• regulator of chromosome condensation 1
• regulator of chromosome condensation
• SNHG3-RCC1 readthrough transcript
• SNHG3-RCC1

Background

Promotes the exchange of Ran-bound GDP by GTP. Involved in the regulation of onset of chromosome condensationin the S phase. Binds to the chromatin. RCC1/Ran complex (together with other proteins) acts as a component of asignal transmission pathway that detects unreplicated DNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RCC1 Antibody (NBP1-85638)(3)

Publications using NBP1-85638

• Gopinathan G, Xu Q, Luan X et Al. CFDP1 regulates the stability of pericentric heterochromatin thereby affecting RAN GTPase activity and mitotic spindle formation PLoS Biol 2024-04-17 [PMID: 38630655]
• Gillon A, Steel C, Cornwall J, Sheard P Increased nuclear permeability is a driver for age-related motoneuron loss Geroscience 2020-01-30 [PMID: 32002784]
• Gillon A, Nielsen K, Steel C et al. Exercise attenuates age-associated changes in motoneuron number, nucleocytoplasmic transport proteins and neuromuscular health Geroscience 2018-04-01 [PMID: 29736782] (Mouse)

Bioinformatics

• Gene Symbol: RCC1