VAP-B Antibody

Images

 
Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in human cell lines Caco-2 and HEK293 using Anti-VAPB antibody. Corresponding VAPB RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: VAP-B Antibody [NBP1-89112] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VAP-B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VAPB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VAP-B Protein (NBP1-89112PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89112 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VAP-B Antibody

  • ALS8
  • ALS8VAMP-B/VAMP-C
  • VAMP (vesicle-associated membrane protein)-associated protein B and C
  • VAMP-associated 33 kDa protein
  • VAMP-associated protein B/C
  • VAMP-B
  • VAMP-C
  • VAPB
  • VAP-B
  • VAP-B/VAP-C
  • VAPC
  • VAP-C
  • vesicle-associated membrane protein-associated protein B/C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-885
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6657
Species: Hu
Applications: WB, IHC

Publications for VAP-B Antibody (NBP1-89112) (0)

There are no publications for VAP-B Antibody (NBP1-89112).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for VAP-B Antibody (NBP1-89112) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IF.

Reviews using NBP1-89112:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence VAP-B NBP1-89112
Enlarge
reviewed by:
Anonymous
IF Human 12/11/2017
View

Summary

ApplicationImmunofluorescence
Sample Tested hela cell
SpeciesHuman
LotB114207

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VAP-B Antibody (NBP1-89112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAP-B Products

Bioinformatics Tool for VAP-B Antibody (NBP1-89112)

Discover related pathways, diseases and genes to VAP-B Antibody (NBP1-89112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAP-B Antibody (NBP1-89112)

Discover more about diseases related to VAP-B Antibody (NBP1-89112).
 

Pathways for VAP-B Antibody (NBP1-89112)

View related products by pathway.

PTMs for VAP-B Antibody (NBP1-89112)

Learn more about PTMs related to VAP-B Antibody (NBP1-89112).

Blogs on VAP-B

There are no specific blogs for VAP-B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
12/11/2017
Application: IF
Species: Human

Bioinformatics

Gene Symbol VAPB
Entrez