RASGRF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASGRF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTE
Specificity
Specificity of human RASGRF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASGRF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASGRF1 Protein (NBP1-85727PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASGRF1 Antibody

  • CDC25guanine nucleotide exchange factor
  • CDC25L
  • GNRPguanine nucleotide-releasing factor 1
  • GRF1
  • GRF55
  • guanine nucleotide-releasing factor, 55 kD
  • Guanine nucleotide-releasing protein
  • H-GRF55
  • PP13187
  • Ras protein-specific guanine nucleotide-releasing factor 1
  • ras-GRF1
  • ras-specific guanine nucleotide-releasing factor 1
  • Ras-specific guanine nucleotide-releasing factor, CDC25 homolog
  • Ras-specific nucleotide exchange factor CDC25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for RASGRF1 Antibody (NBP1-85727) (0)

There are no publications for RASGRF1 Antibody (NBP1-85727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASGRF1 Antibody (NBP1-85727) (0)

There are no reviews for RASGRF1 Antibody (NBP1-85727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASGRF1 Antibody (NBP1-85727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RASGRF1 Antibody (NBP1-85727)

Discover related pathways, diseases and genes to RASGRF1 Antibody (NBP1-85727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASGRF1 Antibody (NBP1-85727)

Discover more about diseases related to RASGRF1 Antibody (NBP1-85727).
 

Pathways for RASGRF1 Antibody (NBP1-85727)

View related products by pathway.

PTMs for RASGRF1 Antibody (NBP1-85727)

Learn more about PTMs related to RASGRF1 Antibody (NBP1-85727).
 

Research Areas for RASGRF1 Antibody (NBP1-85727)

Find related products by research area.

Blogs on RASGRF1

There are no specific blogs for RASGRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASGRF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASGRF1