TDP-43/TARDBP Antibody (2E2-D3)

Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP monoclonal antibody (M01), clone 2E2-D3 Analysis of TARDBP expression in A-431.

Immunocytochemistry/Immunofluorescence: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue Antibody concentration 3 ug/ml.

Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP over-expressed 293 cell line, cotransfected with TARDBP Validated Chimera RNAi ( Cat # H00023435-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TARDBP monoclonal antibody (M01), clone 2E2-D3 (Cat # H00023435-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.Lane 1: TARDBP transfected lysate(44.7 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP in rat tissue samples. Image courtsey of product review by Daniel Pirici.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma. [antibody concentration 3 ug/ml]

Immunoprecipitation: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP transfected lysate using anti-TARDBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TARDBP MaxPab rabbit polyclonal antibody.

ELISA: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
• Clone: 2E2-D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

TDP-43/TARDBP Antibody (2E2-D3) Summary

• Immunogen: TARDBP (AAH01487, 1 a.a. ~ 260 a.a) full length recombinant protein with GST tag. Molecular weight of GST Tag is 26KDa alone. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
• Localization: H00023435-M01 Nucleus.
• Specificity: TARDBP - TAR DNA binding protein
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TARDBP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
• Application Notes: Cross reactivity in Mouse and Rat reported by customer review.
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Cross reactivity in Mouse and Rat reported by customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TDP-43/TARDBP Antibody (2E2-D3)

• ALS10
• ALS10TAR DNA-binding protein-43
• TAR DNA binding protein
• TARDBP
• TDP43
• TDP-43
• TDP-43TAR DNA-binding protein 43

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TDP-43/TARDBP Antibody (H00023435-M01)(173)

Publications using H00023435-M01

• Cortese A, Simone R, Sullivan R et al. Biallelic expansion of an intronic repeat in RFC1 is a common cause of late-onset ataxia Nat. Genet. Apr 1 2019 [PMID: 30926972] (IHC-P, Human)
• Yin P, Guo X, Yang W et al. Caspase-4 mediates cytoplasmic accumulation of TDP-43 in the primate brains. Acta Neuropathol. 2019 Feb 27 [PMID: 30810811]
• Yamashita T, Kato H, Kimura T, and Kwak S Impaired Nucleoporins Are Present in Sporadic Amyotrophic Lateral Sclerosis Motor Neurons that Exhibit Mislocalization of the 43-kDa TAR DNA-Binding Protein. J Clin Neurol. 2019 Mar 04 [PMID: 30618218]
• Gomez-Tortosa E, Baradaran-Heravi Y, Gonzalez Alvarez V et al. Presence of tau astrogliopathy in frontotemporal dementia caused by a novel Grn nonsense (Trp2*) mutation. Neurobiol Aging. 2019 Jan 03 [PMID: 30545478]
• Thammisetty SS, Pedragosa J, Weng YC et al. Age-related deregulation of TDP-43 after stroke enhances NF-?B-mediated inflammation and neuronal damage. J Neuroinflammation Nov 9 2018 [PMID: 30413172]
• Steinacker P, Barschke P, Otto M. et al. Biomarkers for diseases with TDP-43 pathology. Mol Cell Neurosci Nov 3 2018 [PMID: 30399416]
• Neelagandan N, Gonnella G, Dang S et al. TDP-43 enhances translation of specific mRNAs linked to neurodegenerative disease. Nucleic Acids Res. Oct 24 2018 [PMID: 30357366] (WB, Mouse)
• Solomon DA, Stepto A, Au WH et al. A feedback loop between dipeptide-repeat protein, TDP-43 and karyopherin-? mediates C9orf72-related neurodegeneration. Brain Oct 1 2018 [PMID: 30239641]
• Ramos-Campoy O, Avila-Polo R, Grau-Rivera O et al. Systematic Screening of Ubiquitin/p62 Aggregates in Cerebellar Cortex Expands the Neuropathological Phenotype of the C9orf72 Expansion Mutation. J Neuropathol Exp Neurol Jun 7 2018 [PMID: 29889265]
• Pozzi S, Thammisetty SS, Julien JP. et al. Chronic Administration of Pimozide Fails to Attenuate Motor and Pathological Deficits in Two Mouse Models of Amyotrophic Lateral Sclerosis. Neurotherapeutics May 22 2018 [PMID: 29790082]
• Andres-Benito P, Gelpi E, Povedano M et al. Gene Expression Profile in Frontal Cortex in Sporadic Frontotemporal Lobar Degeneration-TDP. J Neuropathol Exp Neurol May 19 2018 [PMID: 29788265]
• Scherz B, Rabl R, Flunkert S et al. mTh1 driven expression of hTDP-43 results in typical ALS/FTLD neuropathological symptoms. PLoS One 2018 May 22 [PMID: 29787578]
• Endo R, Takashima N, Nekooki-Machida Y et al. TAR DNA-Binding Protein 43 and Disrupted in Schizophrenia 1 Coaggregation Disrupts Dendritic Local Translation and Mental Function in Frontotemporal Lobar Degeneration. Biol Psychiatry Mar 29 2018 [PMID: 29752072]
• Deshaies JE, Shkreta L, Moszczynski AJ et al. TDP-43 regulates the alternative splicing of hnRNP A1 to yield an aggregation-prone variant in amyotrophic lateral sclerosis. Brain Mar 19 2018 [PMID: 29562314]
• Grames MS, Dayton RD, Jackson KL et al. Cre-dependent AAV vectors for highly targeted expression of disease-related proteins and neurodegeneration in the substantia nigra. FASEB J Mar 7 2018 [PMID: 29513569]
• Giannoccaro MP, Bartoletti-Stella A, Piras S et al. The First Historically Reported Italian Family with FTD/ALS Teaches a Lesson on C9orf72 RE: Clinical Heterogeneity and Oligogenic Inheritance. J Alzheimers Dis Feb 20 2018 [PMID: 29480190]
• Feneberg E, Gray E, Ansorge O et al. Towards a TDP-43-Based Biomarker for ALS and FTLD. Mol Neurobiol Feb 19 2018 [PMID: 29460270]
• Berson A, Sartoris A, Nativio R et al. TDP-43 Promotes Neurodegeneration by Impairing Chromatin Remodeling Curr. Biol. 2017 Nov 09 [PMID: 29153328] (Human)
• Redaelli V, Rossi G, Maderna E et al. Alzheimer neuropathology without frontotemporal lobar degeneration hallmarks (TAR DNA-binding protein 43 inclusions) in missense progranulin mutation Cys139Arg. Brain Pathol 2016 Dec 20 [PMID: 27997711]
• Koriath CAM, Bocchetta M, Brotherhood E et al. The clinical, neuroanatomical, and neuropathologic phenotype of TBK1-associated frontotemporal dementia: A longitudinal case report. Alzheimers Dement (Amst) 2016 Nov 03 (IHC, Human)
• St-Amour I, Turgeon A, Goupil C et al. Co-occurrence of mixed proteinopathies in late-stage Huntingtons disease. Acta Neuropathol Nov 13 2017 [PMID: 29134321]
• Gregory JM, Whiten DR, Brown RA et al. Clusterin protects neurons against intracellular proteotoxicity. Acta Neuropathol Commun Nov 7 2017 [PMID: 29115989]
• Borrego-Ecija S, Morgado J, Palencia-Madrid L et al. Frontotemporal Dementia Caused by the P301L Mutation in the MAPT Gene: Clinicopathological Features of 13 Cases from the Same Geographical Origin in Barcelona, Spain. Dement Geriatr Cogn Disord Sep 22 2017 [PMID: 28934750]
• Gelpi E, Carrato C, Grau-Lopez L et al. Incidental neuronal intermediate filament inclusion pathology: unexpected biopsy findings in a 37-year old woman with epilepsy. Neuropathol Appl Neurobiol Sep 7 2017 [PMID: 28880406]
• Chang JC, Morton DB. Drosophila lines with mutant and wild type human TDP-43 replacing the endogenous gene reveals phosphorylation and ubiquitination in mutant lines in the absence of viability or lifespan defects. PLoS One 2017 Jul 7 [PMID: 28686708]
• Moreno F, Indakoetxea B, Barandiaran M et al. The unexpected co-occurrence of GRN and MAPT p.A152T in Basque families: Clinical and pathological characteristics. PLoS One 2017 Jun 8 [PMID: 28594853]
• Ash PEA, Stanford EA, Al Abdulatif A et al. Dioxins and related environmental contaminants increase TDP-43 levels. Mol Neurodegener 2017 May 5 [PMID: 28476168]
• Koriath CAM, Bocchetta M, Brotherhood E et al. The clinical, neuroanatomical, and neuropathologic phenotype of TBK1-associated frontotemporal dementia: A longitudinal case report. Alzheimers & Dementia: Diagnosis, Assessment & Disease Monitoring 2016 Nov 3 [PMID: 28229125]
• Wang W, Arakawa H, Wang L et al. Motor-Coordinative and Cognitive Dysfunction Caused by Mutant TDP-43 Could Be Reversed by Inhibiting Its Mitochondrial Localization. Mol Ther 2017 Jan 4 [PMID: 28129109]
• van der Zee J, Gijselinck I, Van Mossevelde S et al. TBK1 Mutation Spectrum in an Extended European Patient Cohort With Frontotemporal Dementia and Amyotrophic Lateral Sclerosis. Hum Mutat 2016 Dec 23 [PMID: 28008748]
• Dutta K, Patel P, Rahimian R et al. Withania somnifera Reverses Transactive Response DNA Binding Protein 43 Proteinopathy in a Mouse Model of Amyotrophic Lateral Sclerosis/Frontotemporal Lobar Degeneration. Neurotherapeutics 2016 Dec 7 [PMID: 27928708]
• Gelpi E, Hoftberger R, Graus F et al. Neuropathological criteria of anti-IgLON5-related tauopathy. Acta Neuropathol 2016 Jun 29 [PMID: 27358064]
• Wang W, Wang L, Lu J et al. The inhibition of TDP-43 mitochondrial localization blocks its neuronal toxicity. Nat Med 2016 Aug [PMID: 27348499]
• Ansoleaga B, Garcia-Esparcia P, Llorens F et al. Altered Mitochondria, Protein Synthesis Machinery, and Purine Metabolism Are Molecular Contributors to the Pathogenesis of Creutzfeldt-Jakob Disease. J Neuropathol Exp Neurol 2016 Jun 12 [PMID: 27297670]
• Koyama A, Sugai A, Kato T et al. Increased cytoplasmic TARDBP mRNA in affected spinal motor neurons in ALS caused by abnormal autoregulation of TDP-43. Nucleic Acids Res 2016 Jul 8 [PMID: 27257061] (WB)
• Mashiko T, Sakashita E, Kasashima K et al. Developmentally Regulated RNA-binding Protein 1 (Drb1)/RNA-binding Motif Protein 45 (RBM45), a Nuclear-Cytoplasmic Trafficking Protein, Forms TAR DNA-binding Protein 43 (TDP-43)-mediated Cytoplasmic Aggregates. J Biol Chem 2016 May 12 [PMID: 27226551]
• De Marco G, Lomartire A, Calvo A et al. Monocytes of patients with amyotrophic lateral sclerosis linked to gene mutations display altered TDP-43 subcellular distribution. Neuropathol Appl Neurobiol 2016 May 14 [PMID: 27178390]
• Williams KL, Topp S, Yang S et al. CCNF mutations in amyotrophic lateral sclerosis and frontotemporal dementia. Nat Commun 2016 Apr 15 [PMID: 27080313] (IP)
• Jiang LL, Zhao J, Yin XF et al. Two mutations G335D and Q343R within the amyloidogenic core region of TDP-43 influence its aggregation and inclusion formation. Sci Rep Mar 31 2016 [PMID: 27030292]
• Solla P, Grau O, Gelpi E et al. Pisa syndrome in a patient with pathologically confirmed Parkinsons disease. Neuropathol Appl Neurobiol Apr 28 2016 [PMID: 26999006]
• Wang G, Yang H, Yan S et al. Cytoplasmic mislocalization of RNA splicing factors and aberrant neuronal gene splicing in TDP-43 transgenic pig brain. Mol Neurodegener. 2015 Sep 03 [PMID: 26334913]
• Lynch DS, Jaunmuktane Z, Sheerin UM et al. Hereditary leukoencephalopathy with axonal spheroids: a spectrum of phenotypes from CNS vasculitis to parkinsonism in an adult onset leukodystrophy series. J Neurol Neurosurg Psychiatry 2016 May [PMID: 25935893]
• Goossens J, Vanmechelen E, Trojanowski JQ et al. TDP-43 as a possible biomarker for frontotemporal lobar degeneration: a systematic review of existing antibodies Acta Neuropathol Commun 2015 Apr 09 [PMID: 25853864]
  
  Details:
  This publication is a systematic review of existing antibodies for TDP-43/TARDBP.
• Xiao S, Sanelli T, Chiang H et al. Low molecular weight species of TDP-43 generated by abnormal splicing form inclusions in amyotrophic lateral sclerosis and result in motor neuron death. Acta Neuropathol. 2015 Mar 19 [PMID: 25788357] (IHC-P, Human)
• Rosenbohm A, Buckert D, Gerischer N et al. Early diagnosis of cardiac involvement in idiopathic inflammatory myopathy by cardiac magnetic resonance tomography. J Neurol. 2015 Feb 12 [PMID: 25673126]
• Saldi TK, Ash PE, Wilson G et al. TDP-1, the Caenorhabditis elegans ortholog of TDP-43, limits the accumulation of double-stranded RNA. EMBO J. 2014 Nov 12 [PMID: 25391662]
• Alafuzoff I, Pikkarainen M, Neumann M et al. Neuropathological assessments of the pathology in frontotemporal lobar degeneration with TDP43-positive inclusions: an inter-laboratory study by the BrainNet Europe consortium. J Neural Transm. 2014 Sep 20 [PMID: 25239189]
• Yarchoan M, Toledo JB, Lee EB et al. Abnormal serine phosphorylation of insulin receptor substrate 1 is associated with tau pathology in Alzheimer's disease and tauopathies. Acta Neuropathol. 2014 Aug 09 [PMID: 25107476] (IHC-P, Human)
• Kara Eleanna, Kiely Aoife P, Proukakis Christos et al. A 6.4 Mb duplication of the alpha-synuclein locus causing frontotemporal dementia and Parkinsonism: phenotype-genotype correlations. JAMA Neurol. 2014 Sep 01 [PMID: 25003242] (Human)
• Robinson AC, Thompson JC, Weedon L et al. No interaction between tau and TDP-43 pathologies in either frontotemporal lobar degeneration or motor neurone disease. Neuropathol Appl Neurobiol. 2014 Apr 15 [PMID: 24861427]
• Chen W, Lonskaya I, Hebron ML et al. Parkin-mediated reduction of nuclear and soluble TDP-43 reverses behavioral decline in symptomatic mice. Hum. Mol. Genet. 2013 [PMID: 24847002]
• Hans F, Fiesel FC, Strong JC et al. UBE2E Ubiquitin-conjugating Enzymes and Ubiquitin Isopeptidase Y Regulate TDP-43 Protein Ubiquitination. J Biol Chem. 2014 May 13 [PMID: 24825905]
• Ohta Y, Tremblay C, Schneider JA et al. Interaction of transactive response DNA binding protein 43 with nuclear factor kappaB in mild cognitive impairment with episodic memory deficits. Acta Neuropathol Commun. 2014 Apr 01 [PMID: 24690380]
• Carlomagno Y, Zhang Y, Davis M et al. Casein Kinase II Induced Polymerization of Soluble TDP-43 into Filaments Is Inhibited by Heat Shock Proteins. PLoS One. 2014 Mar 04 [PMID: 24595055]
• Araki W, Minegishi S, Motoki K et al. Disease-Associated Mutations of TDP-43 Promote Turnover of the Protein Through the Proteasomal Pathway. Mol Neurobiol. 2014 Jan 30 [PMID: 24477737]
• Cortese A, Plagnol V, Brady S et al. Widespread RNA metabolism impairment in sporadic inclusion body myositis TDP43-proteinopathy. Neurobiol Aging. 2013 Dec 30 [PMID: 24462217]
• De Marco Giovanni, Lomartire Annarosa, Mandili Giorgia et al. Reduced cellular Ca(2+) availability enhances TDP-43 cleavage by apoptotic caspases. Biochim Biophys Acta. 2014 Jan 16 [PMID: 24440855] (WB)
• Gelpi E, Navarro-Otano J, Tolosa E et al. Multiple organ involvement by alpha-synuclein pathology in Lewy body disorders. Mov Disord. 2014 Jan 02 [PMID: 24395122]
• Yan S, Wang CE, Wei W et al. TDP-43 Causes Differential Pathology in Neuronal versus Glial Cells in the Mouse Brain. Hum Mol Genet. 2014 Jan 10 [PMID: 24381309]
• Koriath CAM, Bocchetta M, Brotherhood E et al. The clinical, neuroanatomical, and neuropathologic phenotype of TBK1-associated frontotemporal dementia: A longitudinal case report. Alzheimers & Dementia: Diagnosis, Assessment & Disease Monitoring Nov 3 2016
• Balasa M, Gelpi E, Rey MJ et al. Clinical And Neuropathological Variability In Clinically Isolated Central Nervous System Whipple's Disease. Brain Pathol. 2014 Jan 13 [PMID: 24320005]
• Walker AK, Soo KY, Sundaramoorthy V et al. ALS-Associated TDP-43 Induces Endoplasmic Reticulum Stress, Which Drives Cytoplasmic TDP-43 Accumulation and Stress Granule Formation. PLoS One. 2013 Nov 29 [PMID: 24312274]
• Suarez-Calvet M, Dols-Icardo O, Llado A et al. Plasma phosphorylated TDP-43 levels are elevated in patients with frontotemporal dementia carrying a C9orf72 repeat expansion or a GRN mutation. J Neurol Neurosurg Psychiatry. 2013 Dec 04 [PMID: 24309270]
• Hebron M, Chen W, Miessau MJ et al. Parkin reverses TDP-43-induced cell death and failure of amino acid homeostasis. J Neurochem. 2013 Dec 02 [PMID: 24298989]
• Iovino M, Pfisterer U, Holton JL et al. The novel MAPT mutation K298E: mechanisms of mutant tau toxicity, brain pathology and tau expression in induced fibroblast-derived neurons. Acta Neuropathol. 2013 Nov 30 [PMID: 24292008]
• Lashley T, Rohrer JD, Mahoney C et al. A pathogenic progranulin mutation and C9orf72 repeat expansion in a family with frontotemporal dementia. Neuropathol Appl Neurobiol. 2014 Jun 01 [PMID: 24286341]
• Grau-Rivera O, Gelpi E, Rey MJ et al. Prominent psychiatric symptoms in patients with Parkinson's disease and concomitant argyrophilic grain disease. J Neurol. 2013 Sep 18 [PMID: 24046066]
• Medina DX, Orr ME, Oddo S. Accumulation of C-terminal fragments of transactive response DNA-binding protein 43 leads to synaptic loss and cognitive deficits in human TDP-43 transgenic mice. Neurobiol Aging. 2013 Aug 15 [PMID: 23954172] (IHC, ICC/IF, WB, Mouse)
• Xu YF, Prudencio M, Hubbard JM et al. The Pathological Phenotypes of Human TDP-43 Transgenic Mouse Models Are Independent of Downregulation of Mouse Tdp-43. PLoS One 2013 Jul 26 [PMID: 23922830] (WB, Mouse)
• Prell T, Grosskreutz J. The involvement of the cerebellum in amyotrophic lateral sclerosis. Amyotroph Lateral Scler Frontotemporal Degener 2013 Dec [PMID: 23889583] (IHC, Human)
• Finsterer J, Stollberger C, Kovacs GG. Asymptomatic hyper-creatine-kinase-emia as sole manifestation of inclusion body myositis. Neurol Int. 2013 Jun 25 [PMID: 23888214]
• Nishimoto Y, Nakagawa S, Hirose T et al. The long non-coding RNA nuclear-enriched abundant transcript 1_2 induces paraspeckle formation in the motor neuron during the early phase of amyotrophic lateral sclerosis. Mol Brain. 2013 [PMID: 23835137] (IP)
• Mundinano IC, Hernandez M, Dicaudo C et al. Reduced cholinergic olfactory centrifugal inputs in patients with neurodegenerative disorders and MPTP-treated monkeys. Acta Neuropathol. 2013 Jun 20 [PMID: 23784261]
• Tong J, Huang C, Bi F et al. Expression of ALS-linked TDP-43 mutant in astrocytes causes non-cell-autonomous motor neuron death in rats. EMBO J. 2013 May 28 [PMID: 23714777]
• Gelpi E, Cullel F, Navarro-Otano J, Llado A. Globular glial-like inclusions in a patient with advanced Alzheimer's disease. Acta Neuropathol. 2013 May 23 [PMID: 23700215]
• Dayton RD, Gitcho MA, Orchard EA et al. Selective Forelimb Impairment in Rats Expressing a Pathological TDP-43 25 kDa C-terminal Fragment to Mimic Amyotrophic Lateral Sclerosis. Mol Ther. 2013 May 21 [PMID: 23689600]
• Iyer A, Prabowo A, Anink J et al. Cell injury and premature neurodegeneration in focal malformations of cortical development. Brain Pathol. 2013 Mar 11 [PMID: 23586324]
• Iranzo A, Tolosa E, Gelpi E et al. Neurodegenerative disease status and post-mortem pathology in idiopathic rapid-eye-movement sleep behaviour disorder: an observational cohort study. Lancet Neurol. 2013 Mar 06 [PMID: 23562390]
• Bi F, Huang C, Tong J et al. Reactive astrocytes secrete lcn2 to promote neuron death. Proc Natl Acad Sci U S A. 2013 Feb 19 [PMID: 23431168]
• Doherty KM, Rohrer JD, Lees AJ et al. Primary progressive aphasia with parkinsonism: Clinicopathological case. Mov Disord. 2013 Feb 11 [PMID: 23401267]
• Julien J, Swarup V. Methods for Prognostic and/or Diagnostic of Neurodegenerative Disease, Method to Identify Candidate Compounds and Compounds for Treating Neurodegenerative Disease. United States Patent Application. 2016
• Hebron ML, Lonskaya I, Sharpe K et al. Parkin Ubiquitinates Tar-DNA Binding Protein-43 (TDP-43) and Promotes Its Cytosolic Accumulation via Interaction with Histone Deacetylase 6 (HDAC6). J Biol Chem. 2012 Dec 20 [PMID: 23258539]
• Swarup V, Audet JN, Phaneuf D et al. Abnormal Regenerative Responses and Impaired Axonal Outgrowth after Nerve Crush in TDP-43 Transgenic Mouse Models of Amyotrophic Lateral Sclerosis. J Neurosci. 2013 Jan 08 [PMID: 23238732]
• Watanabe S, Kaneko K, Yamanaka K. Accelerated Disease Onset with Stabilized Familial Amyotrophic Lateral Sclerosis (ALS)-linked Mutant TDP-43 Proteins. J Biol Chem. 2012 Dec 12 [PMID: 23235148]
• Tong J, Huang C, Bi F et al. XBP1 Depletion Precedes Ubiquitin Aggregation and Golgi Fragmentation in TDP-43 Transgenic Rats. J Neurochem. 2012 Nov 01 [PMID: 22970712]
• Lopez-Gonzalez I, Carmona M, Blanco R et al. Characterization of Thorn-Shaped Astrocytes in White Matter of Temporal Lobe in Alzheimer's Disease Brains. Brain Pathol. 2012 Aug 13 [PMID: 22882361]
• Verstraete E, Kuiperij HB, van Blitterswijk MM et al. TDP-43 plasma levels are higher in amyotrophic lateral sclerosis. Amyotroph Lateral Scler. 2012 Aug 08 [PMID: 22873561]
• Gelpi E, Soler Insa JM, Parchi P et al. Atypical neuropathological sCJD-MM phenotype with abundant white matter Kuru-type plaques sparing the cerebellar cortex. Neuropathology. 2012 May 18 [PMID: 22862687]
• Colom-Cadena M, Gelpi E, Marti MJ et al. MAPT H1 haplotype is associated with enhanced alpha-synuclein deposition in dementia with Lewy bodies. Neurobiol Aging. 2012 Jun 21 [PMID: 22819391]
• Vilas D, Marti MJ, Botta-Orfila T et al. Pick's pathology in Parkinson's disease with dementia. Neuropathol Appl Neurobiol. 2012 Jun 12 [PMID: 22686686]
• Echavarri C, Burgmans S, Caballero MC et al. Co-occurrence of Different Pathologies in Dementia: Implications for Dementia Diagnosis. J Alzheimers Dis. 2012 Apr 10 [PMID: 22495343]
• Herman AM, Khandelwal PJ, Rebeck GW, Moussa CE. Wild Type TDP-43 Induces Neuro-Inflammation and Alters APP Metabolism in Lentiviral Gene Transfer Models. Exp Neurol. 2012 Feb 28 [PMID: 22402344]
• Troakes C, Maekawa S, Wijesekera L et al. An MND/ALS phenotype associated with C9orf72 repeat expansion: Abundant p62-positive, TDP-43-negative inclusions in cerebral cortex, hippocampus and cerebellum but without associated cognitive decline. Neuropathology. 2011 Dec 19 [PMID: 22181065]
• Dayton RD, Wang DB, Cain CD et al. Frontotemporal lobar degeneration related proteins induce only subtle memory-related deficits when bilaterally overexpressed in the dorsal hippocampus. Exp Neurol. 2011 Dec 09 [PMID: 22177996]
• Huang C, Tong J, Bi F et al. Mutant TDP-43 in motor neurons promotes the onset and progression of ALS in rats. J Clin Invest. 2011 Dec 12 [PMID: 22156203]
• Pirici D, Pirici I, Mogoanta L et al. Matrix metalloproteinase-9 expression in the nuclear compartment of neurons and glial cells in aging and stroke Neuropathology 2012 Oct [PMID: 22151540] (IHC-P, Rat)
• Tsuji H, Nonaka T, Yamashita M et al. Epitope mapping of antibodies against TDP-43 and detection of protease-resistant fragments of pathological TDP-43 in amyotrophic lateral sclerosis and frontotemporal lobar degeneration. Biochem Biophys Res Commun. 2011 Nov 22 [PMID: 22133678]
• Fiesel FC, Weber SS, Supper J et al. TDP-43 regulates global translational yield by splicing of exon junction complex component SKAR. Nucleic Acids Res. 2011 Nov 25 [PMID: 22121224]
• Antonell A, Gelpi E, Sanchez-Valle R et al. Breakpoint Sequence Analysis of an AbPP Locus Duplication Associated with Autosomal Dominant Alzheimers Disease and Severe Cerebral Amyloid Angiopathy. J Alzheimers Dis. 2011 Oct 18 [PMID: 22008262]
• Thom M, Liu JY, Thompson P et al. Neurofibrillary tangle pathology and Braak staging in chronic epilepsy in relation to traumatic brain injury and hippocampal sclerosis: a post-mortem study. Brain. 2011 Sep 08 [PMID: 21903728]
• Wang JW, Brent JR, Tomlinson A et al. The ALS-associated proteins FUS and TDP-43 function together to affect Drosophila locomotion and life span. J Clin Invest. 2011 Sep 01 [PMID: 21881207]
• Swarup V, Phaneuf D, Bareil C et al. Pathological hallmarks of amyotrophic lateral sclerosis/frontotemporal lobar degeneration in transgenic mice produced with TDP-43 genomic fragments. Brain. 2011 Jul 13 [PMID: 21752789]
• Martinez-Saez E, Gelpi E, Rey M et al. Hirano body - rich subtypes of Creutzfeldt-Jakob disease. Neuropathol Appl Neurobiol. 2011 Jul 05 [PMID: 21726270]
• Azizi AA, Li L, Strobel T et al. Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med. Amino Acids. 2011 Jun 12 [PMID: 21667264]
• Lopez-Hernandez T, Sirisi S, Capdevila-Nortes X et al. Molecular mechanisms of MLC1 and GLIALCAM mutations in megalencephalic leukoencephalopathy with subcortical cysts. Hum Mol Genet. 2011 Jun 07 [PMID: 21624973]
• Rusina R, Kovacs GG, Fiala J et al. FTLD-TDP with motor neuron disease, visuospatial impairment and a progressive supranuclear palsy-like syndrome: broadening the clinical phenotype of TDP-43 proteinopathies. A report of three cases. BMC Neurol. 2011 May 10 [PMID: 21569259]
• Mundinano IC, Caballero MC, Ordonez C et al. Increased dopaminergic cells and protein aggregates in the olfactory bulb of patients with neurodegenerative disorders. Acta Neuropathol. 2011 May 08 [PMID: 21553300]
• Pikkarainen M, Hartikainen P, Soininen H, Alafuzoff I. Distribution and Pattern of Pathology in Subjects with Familial or Sporadic Late-Onset Cerebellar Ataxia as Assessed by p62/Sequestosome Immunohistochemistry. Cerebellum. 2011 May 05 [PMID: 21544590]
• Hartikainen PH, Pikkarainen M, Hanninen T et al. Unusual clinical presentation and neuropathology in two subjects with fused-in sarcoma (FUS) positive inclusions. Neuropathology. 2012 Feb [PMID: 21518013] (Human)
• Che MX, Jiang YJ, Xie YY et al. Aggregation of the 35-kDa fragment of TDP-43 causes formation of cytoplasmic inclusions and alteration of RNA processing. FASEB J. 2011 Apr 08 [PMID: 21450909]
• Tian T, Huang C, Tong J et al. TDP-43 Potentiates Alpha-synuclein Toxicity to Dopaminergic Neurons in Transgenic Mice. Int J Biol Sci. 2011 Mar 04 [PMID: 21448284]
• Herman AM, Khandelwal PJ, Stanczyk BB et al. Beta-amyloid triggers ALS-associated TDP-43 pathology in AD models. Brain Res. 2011 Mar 01 [PMID: 21376022]
• Lashley T, Holton JL, Revesz T. TDP-43 pathology may occur in the BRI2 gene-related dementias. Acta Neuropathol. 2011 Feb 22 [PMID: 21340582]
• Rauramaa T, Pikkarainen M, Englund E et al. TAR-DNA binding protein-43 and alterations in the hippocampus. J Neural Transm. 2011 Jan 06 [PMID: 21210283]
• Noto Y, Shibuya K, Sato Y et al. Elevated CSF TDP-43 levels in amyotrophic lateral sclerosis: specificity, sensitivity, and a possible prognostic value. Amyotroph Lateral Scler 2011 Mar [PMID: 21126161]
• De Marco G, Lupino E, Calvo A et al. Cytoplasmic accumulation of TDP-43 in circulating lymphomonocytes of ALS patients with and without TARDBP mutations. Acta Neuropathol. 2010 Dec 01 [PMID: 21120508]
• Higashi S, Tsuchiya Y, Araki T, Wada K, Kabuta T. TDP-43 physically interacts with amyotrophic lateral sclerosis-linked mutant CuZn superoxide dismutase. Neurochem Int 57(8):906-13. 2010 Dec. [PMID: 20933032]
• Wang DB, Dayton RD, Henning PP et al. Expansive Gene Transfer in the Rat CNS Rapidly Produces Amyotrophic Lateral Sclerosis Relevant Sequelae When TDP-43 is Overexpressed. Mol Ther. 2010 Sep 28 [PMID: 20877346]
• Hoftberger R, Fink S, Aboul-Enein F et al. Tubulin polymerization promoting protein (TPPP/p25) as a marker for oligodendroglial changes in multiple sclerosis. Glia 58(15):1847-57. 2010 Nov 15. [PMID: 20737479]
• Shan X, Chiang PM, Price DL, Wong PC. Altered distributions of Gemini of coiled bodies and mitochondria in motor neurons of TDP-43 transgenic mice. Proc Natl Acad Sci U S A 2010 Sep 14 [PMID: 20736350] (WB, Mouse)
• Xu YF, Gendron TF, Zhang YJ et al. Wild-type human TDP-43 expression causes TDP-43 phosphorylation, mitochondrial aggregation, motor deficits, and early mortality in transgenic mice J Neurosci 2010 Aug 11 [PMID: 20702714] (WB, IHC, ICC/IF, Mouse)
• Ling SC, Albuquerque CP, Han JS et al. ALS-associated mutations in TDP-43 increase its stability and promote TDP-43 complexes with FUS/TLS. Proc Natl Acad Sci U S A. 2010 Jul 12 [PMID: 20624952]
• Saito T, Hanai S, Takashima S et al. Neocortical Layer Formation of Human Developing Brains and Lissencephalies: Consideration of Layer-Specific Marker Expression. Cereb Cortex. 2010 Jul 12. [PMID: 20624841]
• Jansen C, Head MW, van Gool WA et al. The first case of protease-sensitive prionopathy (PSPr) in The Netherlands: a patient with an unusual GSS-like clinical phenotype. J Neurol Neurosurg Psychiatry. 2010 Jun 14. [PMID: 20547632]
• Ash PE, Zhang YJ, Roberts CM et al. Neurotoxic effects of TDP-43 overexpression in C. Hum Mol Genet. 19(16):3206-18. 2010 Aug 15. [PMID: 20530643]
• Maruyama H, Morino H, Ito H et al. Mutations of optineurin in amyotrophic lateral sclerosis. Nature. 2010 Apr 18 [PMID: 20428114]
• Braak H, Ludolph A, Thal DR et al. Amyotrophic lateral sclerosis: dash-like accumulation of phosphorylated TDP-43 in somatodendritic and axonal compartments of somatomotor neurons of the lower brainstem and spinal cord. Acta Neuropathol 120(1):67-74. 2010 Jul. [PMID: 20379728]
• Ilieva EV, Naudi A, Kichev A et al. Depletion of oxidative and endoplasmic reticulum stress regulators in Pick disease. Free Radic Biol Med. 2010 Feb 20. [PMID: 20176102]
• Wils H, Kleinberger G, Janssens J et al. TDP-43 transgenic mice develop spastic paralysis and neuronal inclusions characteristic of ALS and frontotemporal lobar degeneration. Proc Natl Acad Sci U S A 107(8):3858-63. 2010 Feb 23. [PMID: 20133711]
• Zhang HX, Tanji K, Yoshida H et al. Alteration of biochemical and pathological properties of TDP-43 protein by a lipid mediator, 15-deoxy-Delta(12,14)-prostaglandin J(2). Exp Neurol 222(2):296-303. 2010 Apr. [PMID: 20083106]
• Fiesel FC, Voigt A, Weber SS et al. Knockdown of transactive response DNA-binding protein (TDP-43) downregulates histone deacetylase 6. EMBO J 29(1):209-21. 2010 Jan 6. [PMID: 19910924]
• Nishimoto Y, Ito D, Yagi T et al. Characterization of alternative isoforms and inclusion body of the TAR DNA-binding protein-43. J Biol Chem 285(1):608-19. 2010 Jan 1. [PMID: 19887443]
• Foulds PG, Davidson Y, Mishra M et al. Plasma phosphorylated-TDP-43 protein levels correlate with brain pathology in frontotemporal lobar degeneration. Acta Neuropathol. 2009 Oct 13. [PMID: 19823856]
• Velakoulis D, Walterfang M, Mocellin R et al. Abnormal hippocampal distribution of TDP-43 in patients with-late onset psychosis. Aust N Z J Psychiatry. 2009 Aug 01 [PMID: 19629795]
• Moisse K, Mepham J, Volkening K et al. Cytosolic TDP-43 expression following axotomy is associated with caspase 3 activation in NFL-/- mice: support for a role for TDP-43 in the physiological response to neuronal injury. Brain Res 1296:176-86. 2009 Nov 3. [PMID: 19619516]
• Velakoulis D, Walterfang M, Mocellin R et al. Frontotemporal dementia presenting as schizophrenia-like psychosis in young people: clinicopathological series review of cases. Br J Psychiatry 194(4):298-305. 2009 Apr. [PMID: 19336778]
• Humayun S, Gohar M, Volkening K et al. The complement factor C5a receptor is upregulated in NFL-/- mouse motor neurons. J Neuroimmunol. 2009 Mar 13. [PMID: 19286267]
• Gitcho MA, Strider J, Carter D et al. VCP mutations causing frontotemporal lobar degeneration disrupt localization of TDP-43 induce cell death. J Biol Chem. 2009 Feb 23. [PMID: 19237541]
• Olive M, Janue A, Moreno D et al. TAR DNA-Binding Protein 43 Accumulation in Protein Aggregate Myopathies. J Neuropathol Exp Neurol. 2009 Mar 01 [PMID: 19225410]
• Rollinson S, Rizzu P, Sikkink S et al. Ubiquitin associated protein 1 is a risk factor for frontotemporal lobar degeneration. Neurobiol Aging 30(4):656-65. 2009 Apr. [PMID: 19217189]
• Igaz LM, Kwong LK, Chen-Plotkin A et al. Expression Of TDP-43 C-terminal fragments in vitro recapitulates pathological features of TDP-43 proteinopathies. J Biol Chem;284(13):8516-24. 2009 Mar 27. [PMID: 19164285]
• Clarimon J, Molina-Porcel L, Gomez-Isla T et al. Early-Onset Familial Lewy Body Dementia With Extensive Tauopathy: A Clinical, Genetic, and Neuropathological Study. J Neuropathol Exp Neurol. 2009 Jan 01 [PMID: 19104444]
• Moisse K, Volkening K, Leystra-Lantz C et al. Divergent patterns of cytosolic TDP-43 neuronal progranulin expression following axotomy: Implications for TDP-43 in the physiological response to neuronal injury. Brain Research,doi:10.1016/j.brainres.2008.10.021. 2008 [PMID: 19046946]
• Schwab C, Arai T, Hasegawa M et al. Colocalization of Transactivation-Responsive DNA-Binding Protein 43 and Huntingtin in Inclusions of Huntington Disease. J Neuropathol Exp Neurol. 2008 Dec 01 [PMID: 19018245]
• Steinacker P, Hendrich C, Sperfeld AD et al. TDP-43 in Cerebrospinal Fluid of Patients With Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis. Arch Neurol. 2008 Nov 01 [PMID: 19001167]
• Seppanen A, Pikkarainen M, Hartikainen P et al. Expression of collagen XVII ubiquitin-binding protein p62 in motor neuron disease. Brain Res;1247:171-7. 2009 Jan 9. [PMID: 18992722]
• Kasai T, Tokuda T, Ishigami N et al. Increased TDP-43 protein in cerebrospinal fluid of patients with amyotrophic lateral sclerosis. Acta Neuropathol;117(1):55-62. 2009 Jan. [PMID: 18989684]
• Nishihira Y, Tan CF, Hoshi Y et al. Sporadic amyotrophic lateral sclerosis of long duration is associated with relatively mild TDP-43 pathology. Acta Neuropathol. 2009 Jan 01 [PMID: 18923836]
• Skoglund L, Brundin R, Olofsson T et al. Frontotemporal dementia in a large Swedish family is caused by a progranulin null mutation. Neurogenetics. 2009 Feb 01 [PMID: 18855025]
• Miklossy J, Steele JC, Yu S et al. Enduring involvement of tau, beta-amyloid, alpha-synuclein, ubiquitin and TDP-43 pathology in the amyotrophic lateral sclerosis/parkinsonism-dementia complex of Guam (ALS/PDC). Acta Neuropathol. 2008 Dec 01 [PMID: 18843496]
• Kovacs GG, Majtenyi K, Spina S et al. White Matter Tauopathy With Globular Glial Inclusions: A Distinct Sporadic Frontotemporal Lobar Degeneration. J Neuropathol Exp Neurol. 2008 Oct 01 [PMID: 18800011]
• Weihl CC, Temiz P, Miller SE et al. TDP-43 accumulation in inclusion body myopathy muscle suggests a common pathogenic mechanism with frontotemporal dementia. J Neurol Neurosurg Psychiatry;79(10):1186-9. 2008 Oct. [PMID: 18796596]
• Lin WL, Dickson DW. Ultrastructural localization of TDP-43 in filamentous neuronal inclusions in various neurodegenerative diseases. Acta Neuropathol;116(2):205-13. 2008 Aug. [PMID: 18607609]
• Mori F, Tanji K, Zhang HX et al. Maturation process of TDP-43-positive neuronal cytoplasmic inclusions in amyotrophic lateral sclerosis with without dementia. Acta Neuropathol;116(2):193-203. 2008 Aug. [PMID: 18560845]
• Sleegers K, Kumar-Singh S, Cruts M, Van Broeckhoven C. Molecular pathogenesis of frontotemporal lobar degeneration: basic science seminar in neurology. Arch Neurol. 2009 Jan 01 [PMID: 18541789]
• Igaz LM, Kwong LK, Xu Y et al. Enrichment of C-Terminal Fragments in TAR DNA-Binding Protein-43 Cytoplasmic Inclusions in Brain but not in Spinal Cord of Frontotemporal Lobar Degeneration Amyotrophic Lateral Sclerosis. Am J Pathol;173(1):182-94. 2008 Jul. [PMID: 18535185]
• Foulds P, McAuley E, Gibbons L et al. TDP-43 protein in plasma may index TDP-43 brain pathology in Alzheimer's disease frontotemporal lobar degeneration. Acta Neuropathol;116(2):141-6. 2008 Aug. [PMID: 18506455]
• Johnson BS, McCaffery JM, Lindquist S, Gitler AD. A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation cellular toxicity. PNAS 105(17):6439-44. 29-Apr-08. [PMID: 18434538]
• Winton MJ, Igaz LM, Wong MM et al. Disturbance of nuclear cytoplasmic Tar DNA binding protein (TDP-43) induces disease-like redistribution, sequestration aggregate formation. J Biol Chem;283(19):13302-9. 2008 May 9. [PMID: 18305110]
• Zhang HX, Tanji K, Mori F et al. Epitope mapping of 2E2-D3, a monoclonal antibody directed against human TDP-43. Neurosci Lett;434(2):170-4. 2008 Mar 28. [PMID: 18304732]
• Beck J, Rohrer JD, Campbell T et al. A distinct clinical, neuropsychological radiological phenotype is associated with progranulin gene mutations in a large UK series. Brain;131(Pt 3):706-20. 2008 Mar. [PMID: 18234697]
• Sanelli T, Xiao S, Horne P et al. Evidence That TDP-43 is Not the Major Ubiquitinated Target Within the Pathological Inclusions of Amyotrophic Lateral Sclerosis. J Neuropathol Exp Neurol. 2007 Dec 01 [PMID: 18090923]
• Kovacs GG, Pittman A, Revesz T et al. MAPT S305I mutation: implications for argyrophilic grain disease. Acta Neuropathol;116(1):103-18. 2008 Jul. [PMID: 18066559]
• Shankaran SS, Capell A, Hruscha AT et al. FTLD-U linked missense mutations in the progranulin gene reduce progranulin production and secretion. J. Biol. Chem. 2008 Jan 18 [PMID: 17984093]
• Zhang H, Tan CF, Mori F et al. TDP-43-immunoreactive neuronal glial inclusions in the neostriatum in amyotrophic lateral sclerosis with without dementia. Acta Neuropathol;115(1):115-22. 2008 Jan. [PMID: 17786458]
• 1 Amador-Ortiz C, Lin WL, Ahmed Z et al. TDP-43 immunoreactivity in hippocampal sclerosis Alzheimer's disease. Ann Neurol;61(5):435-45. 2007 May. [PMID: 17469117]
• Mackenzie IR, Bigio EH, Ince PG et al. Pathological TDP-43 distinguishes sporadic amyotrophic lateral sclerosis from amyotrophic lateral sclerosis with SOD1 mutations. Ann Neurol;61(5):427-34. 2007 May. [PMID: 17469116]
• Hasegawa M, Arai T, Akiyama H et al. TDP-43 is deposited in the Guam parkinsonism-dementia complex brains. Brain;130(Pt 5):1386-94. 2007 May. [PMID: 17439983]
• Fukuda T, Yamagata K, Fujiyama S et al. DEAD-box RNA helicase subunits of the Drosha complex are required for processing of rRNA a subset of microRNAs. Nat Cell Biol;9(5):604-11. 2007 May. [PMID: 17435748]
• Neumann M, Kwong LK, Truax AC et al. TDP-43-positive white matter pathology in frontotemporal lobar degeneration with ubiquitin-positive inclusions. J Neuropathol Exp Neurol;66(3):177-83. 2007 Mar. [PMID: 17356379]
• Tan CF, Eguchi H, Tagawa A et al. TDP-43 immunoreactivity in neuronal inclusions in familial amyotrophic lateral sclerosis with or without SOD1 gene mutation. Acta Neuropathol (Berl);113(5):535-42. 2007 May. [PMID: 17333220]
• Neumann M, Mackenzie IR, Cairns NJ et al. TDP-43 in the ubiquitin pathology of frontotemporal dementia with VCP gene mutations. J Neuropathol Exp Neurol;66(2):152-7. 2007 Feb. [PMID: 17279000]
• Arai T, Hasegawa M, Akiyama H et al. TDP-43 is a component of ubiquitin-positive tau-negative inclusions in frontotemporal lobar degeneration amyotrophic lateral sclerosis. Biochem Biophys Res Commun;351(3):602-11. 2006 Dec 22. [PMID: 17084815]

Reviews for TDP-43/TARDBP Antibody (H00023435-M01) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 review tested in 1 species: Mouse.

reviewed by: Anonymous IHC-P 10/02/2012

Summary

• Application: Immunohistochemistry-Paraffin
• Pub Med ID: 22151540
• File: View PDF

reviewed by: Helen Chiang WB Mouse 06/28/2012

Summary

• Application: Western Blot
• Sample Tested: Mouse Brain Tissue
• Species: Mouse
• Lot: 12076-S1
• Comments: Transgenic mice expressing a C-terminal fragment of human TDP-43 gene

Comments

• Comments: Transgenic mice expressing a C-terminal fragment of human TDP-43 gene

Bioinformatics

• Gene Symbol: TARDBP
• Entrez:
  • 23435(Human)
• OMIM:
  • 605078(Human)
• Uniprot:
  • Q13148()