TDP-43/TARDBP Antibody (2E2-D3)

Images

 
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP monoclonal antibody (M01), clone 2E2-D3 Analysis of TARDBP expression in A-431.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP in rat tissue samples. Image courtsey of product review by Daniel Pirici.
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - PDI co-precipitates with TDP-43/TARDBP and is increased in mutant TDP-43 transgenic mouse spinal cords. Co-immunoprecipitation of wildtype and mutant Q331K ...read more
Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma. [antibody concentration 3 ug/ml]
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.Lane 1: TARDBP transfected lysate(44.7 ...read more
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue Antibody concentration 3 ug/ml.
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP over-expressed 293 cell line, cotransfected with TARDBP Validated Chimera RNAi ( Cat # H00023435-R01V ) (Lane 2) or non-transfected ...read more
ELISA: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
2E2-D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TDP-43/TARDBP Antibody (2E2-D3) Summary

Immunogen
TARDBP (AAH01487, 1 a.a. ~ 260 a.a) full length recombinant protein with GST tag. Molecular weight of GST Tag is 26KDa alone. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Localization
H00023435-M01 Nucleus.
Specificity
TARDBP - TAR DNA binding protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TARDBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
Application Notes
Cross reactivity in Mouse and Rat reported by customer review.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 5
using
H00023435-M01 in the following applications:

Publications
Read Publications using
H00023435-M01 in the following applications:

  • 2 publications
  • IHC
    4 publications
  • 4 publications
  • IP
    2 publications
  • WB
    7 publications

Reactivity Notes

Cross reactivity in Mouse and Rat reported by customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TDP-43/TARDBP Antibody (2E2-D3)

  • ALS10
  • ALS10TAR DNA-binding protein-43
  • TAR DNA binding protein
  • TARDBP
  • TDP43
  • TDP-43
  • TDP-43TAR DNA-binding protein 43

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP1-89117
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF7509
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-93504
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for TDP-43/TARDBP Antibody (H00023435-M01)(173)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IHC, IHC-P, IP, WB.


Filter By Application
ICC/IF
(2)
IHC
(4)
IHC-P
(4)
IP
(2)
WB
(7)
All Applications
Filter By Species
Human
(8)
Mouse
(5)
Rat
(1)
All Species
Showing Publications 1 - 10 of 173. Show All 173 Publications.
Publications using H00023435-M01 Applications Species
Cortese A, Simone R, Sullivan R et al. Biallelic expansion of an intronic repeat in RFC1 is a common cause of late-onset ataxia Nat. Genet. Apr 1 2019 [PMID: 30926972] (IHC-P, Human) IHC-P Human
Yin P, Guo X, Yang W et al. Caspase-4 mediates cytoplasmic accumulation of TDP-43 in the primate brains. Acta Neuropathol. 2019 Feb 27 [PMID: 30810811]
Yamashita T, Kato H, Kimura T, and Kwak S Impaired Nucleoporins Are Present in Sporadic Amyotrophic Lateral Sclerosis Motor Neurons that Exhibit Mislocalization of the 43-kDa TAR DNA-Binding Protein. J Clin Neurol. 2019 Mar 04 [PMID: 30618218]
Gomez-Tortosa E, Baradaran-Heravi Y, Gonzalez Alvarez V et al. Presence of tau astrogliopathy in frontotemporal dementia caused by a novel Grn nonsense (Trp2*) mutation. Neurobiol Aging. 2019 Jan 03 [PMID: 30545478]
Thammisetty SS, Pedragosa J, Weng YC et al. Age-related deregulation of TDP-43 after stroke enhances NF-?B-mediated inflammation and neuronal damage. J Neuroinflammation Nov 9 2018 [PMID: 30413172]
Steinacker P, Barschke P, Otto M. et al. Biomarkers for diseases with TDP-43 pathology. Mol Cell Neurosci Nov 3 2018 [PMID: 30399416]
Neelagandan N, Gonnella G, Dang S et al. TDP-43 enhances translation of specific mRNAs linked to neurodegenerative disease. Nucleic Acids Res. Oct 24 2018 [PMID: 30357366] (WB, Mouse) WB Mouse
Solomon DA, Stepto A, Au WH et al. A feedback loop between dipeptide-repeat protein, TDP-43 and karyopherin-? mediates C9orf72-related neurodegeneration. Brain Oct 1 2018 [PMID: 30239641]
Ramos-Campoy O, Avila-Polo R, Grau-Rivera O et al. Systematic Screening of Ubiquitin/p62 Aggregates in Cerebellar Cortex Expands the Neuropathological Phenotype of the C9orf72 Expansion Mutation. J Neuropathol Exp Neurol Jun 7 2018 [PMID: 29889265]
Pozzi S, Thammisetty SS, Julien JP. et al. Chronic Administration of Pimozide Fails to Attenuate Motor and Pathological Deficits in Two Mouse Models of Amyotrophic Lateral Sclerosis. Neurotherapeutics May 22 2018 [PMID: 29790082]
Show All 173 Publications.

Reviews for TDP-43/TARDBP Antibody (H00023435-M01) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 review tested in 1 species: Mouse.

Reviews using H00023435-M01:
Filter by Applications
IHC-P
(1)
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin TDP-43/TARDBP H00023435-M01
Enlarge
reviewed by:
Anonymous
IHC-P 10/02/2012
View

Summary

ApplicationImmunohistochemistry-Paraffin
Pub Med ID22151540
FileView PDF
Western Blot TDP-43/TARDBP H00023435-M01
Enlarge
reviewed by:
Helen Chiang
WB Mouse 06/28/2012
View

Summary

ApplicationWestern Blot
Sample TestedMouse Brain Tissue
SpeciesMouse
Lot12076-S1
CommentsTransgenic mice expressing a C-terminal fragment of human TDP-43 gene

Comments

CommentsTransgenic mice expressing a C-terminal fragment of human TDP-43 gene

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TDP-43/TARDBP Antibody (H00023435-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TDP-43/TARDBP Products

Bioinformatics Tool for TDP-43/TARDBP Antibody (H00023435-M01)

Discover related pathways, diseases and genes to TDP-43/TARDBP Antibody (H00023435-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDP-43/TARDBP Antibody (H00023435-M01)

Discover more about diseases related to TDP-43/TARDBP Antibody (H00023435-M01).
 

Pathways for TDP-43/TARDBP Antibody (H00023435-M01)

View related products by pathway.

PTMs for TDP-43/TARDBP Antibody (H00023435-M01)

Learn more about PTMs related to TDP-43/TARDBP Antibody (H00023435-M01).
 

Research Areas for TDP-43/TARDBP Antibody (H00023435-M01)

Find related products by research area.

Blogs on TDP-43/TARDBP

There are no specific blogs for TDP-43/TARDBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Anonymous
10/02/2012
Application: IHC-P
Species:

Helen Chiang
06/28/2012
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol TARDBP
Entrez
OMIM
Uniprot
COVID-19 update