alpha 2-Macroglobulin Antibody

Images

 
Western Blot: Alpha 2 Macroglobulin Antibody [NBP1-85491] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane ...read more
Immunohistochemistry-Paraffin: Alpha 2 Macroglobulin Antibody [NBP1-85491] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha 2-Macroglobulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A2M
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alpha 2-Macroglobulin Protein (NBP1-85491PEP)
Publications
Read Publications using NBP1-85491.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha 2-Macroglobulin Antibody

  • A2M
  • alpha 2Macroglobulin
  • alpha 2-Macroglobulin
  • alpha-2-M
  • alpha-2-macroglobulin
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
  • CPAMD5
  • CPAMD5DKFZp779B086
  • FWP007
  • S863-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-12553
Species: Hu
AF1267
Species: Hu
Applications: WB, IP, Neut
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4409
Species: Mu
Applications: WB
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for alpha 2-Macroglobulin Antibody (NBP1-85491)(2)

Reviews for alpha 2-Macroglobulin Antibody (NBP1-85491) (0)

There are no reviews for alpha 2-Macroglobulin Antibody (NBP1-85491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha 2-Macroglobulin Antibody (NBP1-85491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha 2-Macroglobulin Products

Bioinformatics Tool for alpha 2-Macroglobulin Antibody (NBP1-85491)

Discover related pathways, diseases and genes to alpha 2-Macroglobulin Antibody (NBP1-85491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha 2-Macroglobulin Antibody (NBP1-85491)

Discover more about diseases related to alpha 2-Macroglobulin Antibody (NBP1-85491).
 

Pathways for alpha 2-Macroglobulin Antibody (NBP1-85491)

View related products by pathway.

PTMs for alpha 2-Macroglobulin Antibody (NBP1-85491)

Learn more about PTMs related to alpha 2-Macroglobulin Antibody (NBP1-85491).
 

Research Areas for alpha 2-Macroglobulin Antibody (NBP1-85491)

Find related products by research area.

Blogs on alpha 2-Macroglobulin

There are no specific blogs for alpha 2-Macroglobulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha 2-Macroglobulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol A2M
Entrez