Sorbitol Dehydrogenase Antibody

Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human thyroid gland shows high expression.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining in human thyroid gland and skeletal muscle tissues using anti-SORD antibody. Corresponding SORD RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Sorbitol Dehydrogenase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
• Specificity: Specificity of human Sorbitol Dehydrogenase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SORD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Sorbitol Dehydrogenase Protein (NBP1-87416PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sorbitol Dehydrogenase Antibody

• EC 1.1.1
• EC 1.1.1.14
• L-iditol 2-dehydrogenase
• sorbitol dehydrogenase
• SORD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sorbitol Dehydrogenase Antibody (NBP1-87416)(1)

Publication using NBP1-87416

• Uzozie A, Nanni P, Staiano T et al. Sorbitol Dehydrogenase Overexpression and Other Aspects of Dysregulated Protein Expression in Human Precancerous Colorectal Neoplasms: A Quantitative Proteomics Study. Mol Cell Proteomics 2014 May [PMID: 24567419] (IHC, WB, Human)

Bioinformatics

• Gene Symbol: SORD