Home » Sorbitol Dehydrogenase » Sorbitol Dehydrogenase Antibodies » Sorbitol Dehydrogenase Antibody

Sorbitol Dehydrogenase Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney, liver, prostate and skeletal muscle using Anti-SORD antibody NBP1-87416 (A) shows ...read more
Independent Antibodies: Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).
Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Sorbitol Dehydrogenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC, WB reported in scientific literature (PMID: 24567419). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sorbitol Dehydrogenase Protein (NBP1-87416PEP)
Publications
Read Publication using
NBP1-87416 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sorbitol Dehydrogenase Antibody

  • EC 1.1.1
  • EC 1.1.1.14
  • L-iditol 2-dehydrogenase
  • sorbitol dehydrogenase
  • SORD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SDHB Antibody
NBP1-87069
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Staining of human liver shows moderate to strong granular cytoplasmic postivity in hepatocytes.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
(16 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Serine Dehydratase
Antibody (OTI3D3)
NBP2-01506
Flow Cytometry: Serine Dehydratase Antibody (3D3) [NBP2-01506] - Analysis of Jurkat cells, using anti-Serine Dehydratase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Serine Dehydratase Antibody (3D3) [NBP2-01506] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Serine Dehydratase antibody, and then analyzed by flow cytometry.
Western Blot: Serine Dehydratase Antibody (3D3) [NBP2-01506] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Serine Dehydratase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by Serine Dehydratase-PAGE and immunoblotted with anti-Serine Dehydratase.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SDSL Antibody
(OTI1A8) - Azide and ...
NBP2-74045
Western Blot: SDSL Antibody (OTI1A8) - Azide and BSA Free [NBP2-74045] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SDSL.
Flow Cytometry: SDSL Antibody (OTI1A8) - Azide and BSA Free [NBP2-74045] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by SDSL antibody.
Immunohistochemistry: SDSL Antibody (OTI1A8) - Azide and BSA Free [NBP2-74045] - Analysis of Carcinoma of Human thyroid tissue.
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Flow Cytometry: AKR1A1 Antibody (6E3) [NBP2-02164] - Analysis of Hela cells, using anti-AKR1A1 antibody, (Red) compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: AKR1A1 Antibody (6E3) [NBP2-02164] - Analysis of Jurkat cells, using anti-AKR1A1 antibody, (Red) compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: AKR1A1 Antibody (6E3) [NBP2-02164] - HEK293T cells transfected with either pCMV6-ENTRY AKR1A1.(Red) or empty vector control plasmid (Blue) were immunostained with anti-AKR1A1 mouse monoclonal, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
alcohol
dehydrogenase 4 Antib
NBP1-90233
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
alcohol
dehydrogenase Antibod ...
NBP2-75398
Immunocytochemistry/Immunofluorescence: alcohol dehydrogenase Antibody (JG82-31) [NBP2-75398] - Staining Alcohol Dehydrogenase in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: alcohol dehydrogenase Antibody (JG82-31) [NBP2-75398] - Analysis of paraffin-embedded human liver tissue using anti-Alcohol Dehydrogenase antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: alcohol dehydrogenase Antibody (JG82-31) [NBP2-75398] - Analysis of paraffin-embedded mouse liver tissue using anti-Alcohol Dehydrogenase antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
alcohol
dehydrogenase 1C Anti
NBP2-92824
Immunohistochemistry-Paraffin: alcohol dehydrogenase 1C Antibody [NBP2-92824] - Paraffin-embedded human esophagus using alcohol dehydrogenase 1C .
Western Blot: alcohol dehydrogenase 1C Antibody [NBP2-92824] - Analysis of extracts of various cell lines, using alcohol dehydrogenase 1C .Exposure time: 10s.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 1C Antibody [NBP2-92824] - Paraffin-embedded human stomach using alcohol dehydrogenase 1C .
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
alcohol
dehydrogenase 1B Anti ...
NBP2-00649
Western Blot: alcohol dehydrogenase 1B Antibody (OTI4F12) [NBP2-00649] - Analysis of extracts (10ug) from 9 Human tissue by using anti-ADH1B monoclonal antibody at 1:1000 (1: Testis; 2: Omentum; 3: Uterus; 4: Breast; 5: Brain; 6: Liver; 7: Ovary; 8: Thyroid gland; 9: colon).
Flow Cytometry: alcohol dehydrogenase 1B Antibody (OTI4F12) [NBP2-00649] - Analysis of Hela cells, using anti-alcohol dehydrogenase 1B antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: alcohol dehydrogenase 1B Antibody (OTI4F12) [NBP2-00649] - Analysis of Jurkat cells, using anti-alcohol dehydrogenase 1B antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
alcohol
dehydrogenase 6 Antib
NBP2-62658
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P, WB
GGT1 Antibody (1F9)
H00002678-M01
Western Blot: GGT1 Antibody (1F9) [H00002678-M01] - GGT1 monoclonal antibody (M01), clone 1F9 Analysis of GGT1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Immunoprecipitation: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.
(7 Publications)
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Amphiregulin
[Biotin]
DY262
(1 Review)
(39 Publications)
Species: Hu
Applications: ELISA
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
GGTLC1 Antibody
NBP1-56928
Western Blot: GGTLC1 Antibody [NBP1-56928] - Antibody Titration: 5.0ug/ml Positive Control: Human kidney
Immunohistochemistry-Paraffin: GGTLC1 Antibody [NBP1-56928] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: IHC, IHC-P, WB
GPT Antibody
NBP1-89111
Western Blot: GPT Antibody [NBP1-89111] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human tonsil shows low expression as expected.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Sorbitol
Dehydrogenase Antibod
NBP1-87416
Sorbitol Dehydrogenase Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sorbitol Dehydrogenase Antibody (NBP1-87416)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)

There are no reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sorbitol Dehydrogenase Products

Bioinformatics Tool for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Discover related pathways, diseases and genes to Sorbitol Dehydrogenase Antibody (NBP1-87416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Discover more about diseases related to Sorbitol Dehydrogenase Antibody (NBP1-87416).
 

Pathways for Sorbitol Dehydrogenase Antibody (NBP1-87416)

View related products by pathway.

PTMs for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Learn more about PTMs related to Sorbitol Dehydrogenase Antibody (NBP1-87416).
 

Research Areas for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Find related products by research area.

Blogs on Sorbitol Dehydrogenase

There are no specific blogs for Sorbitol Dehydrogenase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sorbitol Dehydrogenase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SORD