Sorbitol Dehydrogenase Antibody


Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA more
Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining in human thyroid gland and skeletal muscle tissues using anti-SORD antibody. Corresponding SORD RNA-seq data are presented for the more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Sorbitol Dehydrogenase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Specificity of human Sorbitol Dehydrogenase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sorbitol Dehydrogenase Protein (NBP1-87416PEP)
Read Publication using
NBP1-87416 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Sorbitol Dehydrogenase Antibody

  • EC 1.1.1
  • EC
  • L-iditol 2-dehydrogenase
  • sorbitol dehydrogenase
  • SORD1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Sorbitol Dehydrogenase Antibody (NBP1-87416)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)

There are no reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Sorbitol Dehydrogenase Products

Bioinformatics Tool for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Discover related pathways, diseases and genes to Sorbitol Dehydrogenase Antibody (NBP1-87416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Discover more about diseases related to Sorbitol Dehydrogenase Antibody (NBP1-87416).

Pathways for Sorbitol Dehydrogenase Antibody (NBP1-87416)

View related products by pathway.

PTMs for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Learn more about PTMs related to Sorbitol Dehydrogenase Antibody (NBP1-87416).

Research Areas for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Find related products by research area.

Blogs on Sorbitol Dehydrogenase

There are no specific blogs for Sorbitol Dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sorbitol Dehydrogenase Antibody and receive a gift card or discount.


Gene Symbol SORD