Sorbitol Dehydrogenase Antibody

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney, liver, prostate and skeletal muscle using Anti-SORD antibody NBP1-87416 (A) shows similar protein distribution across tissues to independent antibody NBP1-87415 (B).

Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).

Immunocytochemistry/Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Sorbitol Dehydrogenase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SORD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC, WB reported in scientific literature (PMID: 24567419). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Sorbitol Dehydrogenase Protein (NBP1-87416PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sorbitol Dehydrogenase Antibody

• EC 1.1.1
• EC 1.1.1.14
• L-iditol 2-dehydrogenase
• sorbitol dehydrogenase
• SORD1

Background

Sorbitol dehydrogenase (SDH), a member of the medium-chain dehydrogenase/reductase protein family and the second enzyme of the polyol pathway of glucose metabolism, converts sorbitol to fructose strictly using NAD(+) as coenzyme. SDH is expressed almost ubiquitously in all mammalian tissues. The enzyme has attracted considerable interest due to its implication in the development of diabetic complications as the polyol pathway is particularly active in hyperglycemic states. Although SORD is closely related to the class I long-chain alcohol dehydrogenases, it differs in substrate specificity, catalyzing polyols such as sorbitol and xylitol but having no activity towards primary alcohols.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sorbitol Dehydrogenase Antibody (NBP1-87416)(1)

Publication using NBP1-87416

• Uzozie A, Nanni P, Staiano T et al. Sorbitol Dehydrogenase Overexpression and Other Aspects of Dysregulated Protein Expression in Human Precancerous Colorectal Neoplasms: A Quantitative Proteomics Study. Mol Cell Proteomics 2014-05-01 [PMID: 24567419] (IF/IHC, WB, Human)

Bioinformatics

• Gene Symbol: SORD