Home » Sorbitol Dehydrogenase » Sorbitol Dehydrogenase Antibodies » Sorbitol Dehydrogenase Antibody

Sorbitol Dehydrogenase Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).
Independent Antibodies: Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).
Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle using Anti-SORD antibody NBP1-87416.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human thyroid gland using Anti-SORD antibody NBP1-87416.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney, liver, prostate and skeletal muscle using Anti-SORD antibody NBP1-87416 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

Sorbitol Dehydrogenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Specificity
Specificity of human Sorbitol Dehydrogenase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC, WB reported in scientific literature (PMID: 24567419). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sorbitol Dehydrogenase Protein (NBP1-87416PEP)
Publications
Read Publication using
NBP1-87416 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sorbitol Dehydrogenase Antibody

  • EC 1.1.1
  • EC 1.1.1.14
  • L-iditol 2-dehydrogenase
  • sorbitol dehydrogenase
  • SORD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SDHB Antibody
NBP1-87069
Western Blot: SDHB Antibody [NBP1-87069] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SDHB antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: SDHB Antibody [NBP1-87069] - Staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Staining of human liver shows moderate to strong granular cytoplasmic postivity in hepatocytes.
(15 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Serine Dehydratase
Antibody (OTI3D3)
NBP2-01506
Western Blot: Serine Dehydratase Antibody (3D3) [NBP2-01506] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Serine Dehydratase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by Serine Dehydratase-PAGE and immunoblotted with anti-Serine Dehydratase.
Immunocytochemistry/Immunofluorescence: Serine Dehydratase Antibody (3D3) [NBP2-01506] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Serine Dehydratase.
Immunohistochemistry-Paraffin: Serine Dehydratase Antibody (3D3) [NBP2-01506] - Staining of paraffin-embedded Human breast tissue using anti-Serine Dehydratase mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SDSL Antibody
(OTI1A8) - Azide and ...
NBP2-74045
Western Blot: SDSL Antibody (OTI1A8) - Azide and BSA Free [NBP2-74045] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SDSL.
Immunohistochemistry: SDSL Antibody (OTI1A8) - Azide and BSA Free [NBP2-74045] - Analysis of Human liver tissue.
Flow Cytometry: SDSL Antibody (OTI1A8) - Azide and BSA Free [NBP2-74045] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by SDSL antibody.
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AKR1B1 Antibody
NBP1-89146
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Western Blot: AKR1A1 Antibody (6E3) [NBP2-02164] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY AKR1A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-AKR1A1.
Immunocytochemistry/Immunofluorescence: AKR1A1 Antibody (6E3) [NBP2-02164] Staining of COS7 cells transiently transfected by pCMV6-ENTRY AKR1A1.
Immunohistochemistry-Paraffin: AKR1A1 Antibody (6E3) [NBP2-02164] - Staining of paraffin-embedded liver tissue using anti-AKR1A1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
alcohol
dehydrogenase 4 Antib
NBP1-90233
Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
alcohol
dehydrogenase Antibod ...
NBP2-75398
Western Blot: alcohol dehydrogenase Antibody (JG82-31) [NBP2-75398] - Analysis of Alcohol Dehydrogenase on rat liver tissue lysate using anti-Alcohol Dehydrogenase antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: alcohol dehydrogenase Antibody (JG82-31) [NBP2-75398] - Staining Alcohol Dehydrogenase in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: alcohol dehydrogenase Antibody (JG82-31) [NBP2-75398] - Analysis of paraffin-embedded rat liver tissue using anti-Alcohol Dehydrogenase antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
alcohol
dehydrogenase 1C Anti
NBP2-92824
Western Blot: alcohol dehydrogenase 1C Antibody [NBP2-92824] - Analysis of extracts of various cell lines, using alcohol dehydrogenase 1C.Exposure time: 10s.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 1C Antibody [NBP2-92824] - Paraffin-embedded human stomach using alcohol dehydrogenase 1C.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 1C Antibody [NBP2-92824] - Paraffin-embedded human esophagus using alcohol dehydrogenase 1C.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
alcohol
dehydrogenase 1B Anti ...
NBP2-70092
Western Blot: alcohol dehydrogenase 1B Antibody (OTI4F12) - Azide and BSA Free [NBP2-70092] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY alcohol dehydrogenase 1B (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with an
Immunocytochemistry/Immunofluorescence: alcohol dehydrogenase 1B Antibody (OTI4F12) - Azide and BSA Free [NBP2-70092] - Staining of HeLa cells using anti-alcohol dehydrogenase 1B mouse monoclonal antibody.
Immunohistochemistry: alcohol dehydrogenase 1B Antibody (OTI4F12) - Azide and BSA Free [NBP2-70092] - Staining of paraffin-embedded Human liver tissue using anti-alcohol dehydrogenase 1B mouse monoclonal antibody.
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
alcohol
dehydrogenase 6 Antib
NBP2-62658
Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis using Anti-ADH6 antibody NBP2-62658 (A) shows similar pattern to independent antibody NBP2-62661 (B).
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human testis.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
GGT1 Antibody (1F9)
H00002678-M01
Western Blot: GGT1 Antibody (1F9) [H00002678-M01] - GGT1 monoclonal antibody (M01), clone 1F9 Analysis of GGT1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Immunoprecipitation: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.
(7 Publications)
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(13 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and lymph node tissues using NBP2-38530 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Amphiregulin [HRP]
DAR00
(6 Reviews)
(9 Publications)
Species: Hu
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(39 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
GGTLC1 Antibody
NBP1-56928
Western Blot: GGTLC1 Antibody [NBP1-56928] - Antibody Titration: 5.0ug/ml Positive Control: Human kidney
Immunohistochemistry-Paraffin: GGTLC1 Antibody [NBP1-56928] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: WB, IHC, IHC-P
GPT Antibody
NBP1-89111
Western Blot: GPT Antibody [NBP1-89111] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: GPT Antibody [NBP1-89111] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Western Blot: GPT Antibody [NBP1-89111] - Analysis in human liver tissue.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Sorbitol
Dehydrogenase Antibod
NBP1-87416
Sorbitol Dehydrogenase Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sorbitol Dehydrogenase Antibody (NBP1-87416)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)

There are no reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Sorbitol Dehydrogenase Products

Bioinformatics Tool for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Discover related pathways, diseases and genes to Sorbitol Dehydrogenase Antibody (NBP1-87416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Discover more about diseases related to Sorbitol Dehydrogenase Antibody (NBP1-87416).
 

Pathways for Sorbitol Dehydrogenase Antibody (NBP1-87416)

View related products by pathway.

PTMs for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Learn more about PTMs related to Sorbitol Dehydrogenase Antibody (NBP1-87416).
 

Research Areas for Sorbitol Dehydrogenase Antibody (NBP1-87416)

Find related products by research area.

Blogs on Sorbitol Dehydrogenase

There are no specific blogs for Sorbitol Dehydrogenase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sorbitol Dehydrogenase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SORD