Independent Antibodies: Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).
Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle using Anti-SORD antibody NBP1-87416.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human thyroid gland using Anti-SORD antibody NBP1-87416.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney, liver, prostate and skeletal muscle using Anti-SORD antibody NBP1-87416 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
This antibody was developed against Recombinant Protein corresponding to amino acids: LLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Specificity
Specificity of human Sorbitol Dehydrogenase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC, WB reported in scientific literature (PMID: 24567419). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 24567419).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Sorbitol Dehydrogenase Antibody
EC 1.1.1
EC 1.1.1.14
L-iditol 2-dehydrogenase
sorbitol dehydrogenase
SORD1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416) (0)
There are no reviews for Sorbitol Dehydrogenase Antibody (NBP1-87416).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Bioinformatics Tool for Sorbitol Dehydrogenase Antibody (NBP1-87416)
Discover related pathways, diseases and genes to Sorbitol Dehydrogenase Antibody (NBP1-87416). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Sorbitol Dehydrogenase Antibody (NBP1-87416)
Discover more about diseases related to Sorbitol Dehydrogenase Antibody (NBP1-87416).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Sorbitol Dehydrogenase Antibody and receive a gift card or discount.
PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation
Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally.