alcohol dehydrogenase 6 Antibody


Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human liver shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

alcohol dehydrogenase 6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alcohol dehydrogenase 6 Recombinant Protein Antigen (NBP2-62658PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for alcohol dehydrogenase 6 Antibody

  • ADH-5
  • alcohol dehydrogenase 6 (class V)
  • alcohol dehydrogenase 6
  • aldehyde reductase
  • EC 1.1.1
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Fi, Ze
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for alcohol dehydrogenase 6 Antibody (NBP2-62658) (0)

There are no publications for alcohol dehydrogenase 6 Antibody (NBP2-62658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 6 Antibody (NBP2-62658) (0)

There are no reviews for alcohol dehydrogenase 6 Antibody (NBP2-62658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 6 Antibody (NBP2-62658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for alcohol dehydrogenase 6 Antibody (NBP2-62658)

Discover related pathways, diseases and genes to alcohol dehydrogenase 6 Antibody (NBP2-62658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 6 Antibody (NBP2-62658)

Discover more about diseases related to alcohol dehydrogenase 6 Antibody (NBP2-62658).

Pathways for alcohol dehydrogenase 6 Antibody (NBP2-62658)

View related products by pathway.

PTMs for alcohol dehydrogenase 6 Antibody (NBP2-62658)

Learn more about PTMs related to alcohol dehydrogenase 6 Antibody (NBP2-62658).

Blogs on alcohol dehydrogenase 6

There are no specific blogs for alcohol dehydrogenase 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our alcohol dehydrogenase 6 Antibody and receive a gift card or discount.


Gene Symbol ADH6