alcohol dehydrogenase 6 Antibody

Images

 
Independent Antibodies: Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis using Anti-ADH6 antibody NBP2-62658 (A) shows similar pattern to independent antibody NBP2-62661 (B).
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human testis.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon, kidney, liver and testis using Anti-ADH6 antibody NBP2-62658 (A) shows similar ...read more
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alcohol dehydrogenase 6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADH6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alcohol dehydrogenase 6 Recombinant Protein Antigen (NBP2-62658PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for alcohol dehydrogenase 6 Antibody

  • ADH-5
  • alcohol dehydrogenase 6 (class V)
  • alcohol dehydrogenase 6
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-1162
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Pm, Pm, Rb
Applications: IHC, IHC-P, ICC
NBP2-95141
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32828
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-62658
Species: Hu
Applications: WB, IHC, IHC-P

Publications for alcohol dehydrogenase 6 Antibody (NBP2-62658) (0)

There are no publications for alcohol dehydrogenase 6 Antibody (NBP2-62658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 6 Antibody (NBP2-62658) (0)

There are no reviews for alcohol dehydrogenase 6 Antibody (NBP2-62658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 6 Antibody (NBP2-62658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional alcohol dehydrogenase 6 Products

Bioinformatics Tool for alcohol dehydrogenase 6 Antibody (NBP2-62658)

Discover related pathways, diseases and genes to alcohol dehydrogenase 6 Antibody (NBP2-62658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 6 Antibody (NBP2-62658)

Discover more about diseases related to alcohol dehydrogenase 6 Antibody (NBP2-62658).
 

Pathways for alcohol dehydrogenase 6 Antibody (NBP2-62658)

View related products by pathway.

PTMs for alcohol dehydrogenase 6 Antibody (NBP2-62658)

Learn more about PTMs related to alcohol dehydrogenase 6 Antibody (NBP2-62658).

Blogs on alcohol dehydrogenase 6

There are no specific blogs for alcohol dehydrogenase 6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH6