Novus Biologicals products are now on bio-techne.com

PLAG1 Antibody (3B7)

Images

 
Western Blot detection against Immunogen (36.52 KDa) .
Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5mm) and enlargement of selected areas (lower panels, scale bars=100um). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 ...read more
Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
Detection of the FGFR1-PLAG1 and TGFBR3-PLAG1 fusion genes.e) Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5 mm) and enlargement of selected areas (lower panels, scale bars=100 ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC
Clone
3B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLAG1 Antibody (3B7) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLAG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC usage was reported in scientific literature.
Publications
Read Publications using
H00005324-M02 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLAG1 Antibody (3B7)

  • COL1A2/PLAG1 fusion
  • Pleiomorphic adenoma gene 1 protein
  • pleiomorphic adenoma gene 1
  • SGPA
  • zinc finger protein PLAG1
  • ZNF912

Background

Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06046
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00005324-M02
Species: Hu, Mu
Applications: WB, ELISA, IHC

Publications for PLAG1 Antibody (H00005324-M02)(19)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IF/IHC, IHC-P.


Filter By Application
ICC/IF
(1)
IF/IHC
(3)
IHC-P
(2)
All Applications
Filter By Species
Human
(8)
All Species
Showing Publications 1 - 10 of 19. Show All 19 Publications.
Publications using H00005324-M02 Applications Species
Sanchez-Avila M, Tjendra Y, Zuo Y et al. Don't SUMP it! Utility of PLAG1 immunocytochemistry in basaloid SUMP subcategory Cancer cytopathology 2023-09-13 [PMID: 37702124] (ICC/IF, Human) ICC/IF Human
Anderson WJ, Mariño-Enríquez A, Trpkov K et al. Expanding the Clinicopathologic and Molecular Spectrum of Lipoblastoma-like Tumor in a Series of 28 Cases Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2023-06-22 [PMID: 37355153]
Yoon YJ, Kim D, Tak KY et al. Salivary gland organoid culture maintains distinct glandular properties of murine and human major salivary glands Nature communications 2022-06-07 [PMID: 35672412] (IF/IHC, Human) IF/IHC Human
Adepitan O, Olufunlola A, Oluwole O et al. HMGA2 Immunoexpression is frequent in salivary gland pleomorphic adenoma: immunohistochemical and molecular analyses of PLAG1 and HMGA2 in 25 cases. Int J Clin Exp Pathol. 2022-02-15 [PMID: 35265254]
Gerhard-Hartmann E, Vokuhl C, Roth S Et al. The histological and molecular spectrum of lipoblastoma: A case series with identification of three novel gene fusions by targeted RNA-sequencing Pathology, research and practice 2021-08-18 [PMID: 34455363] (IHC-P, Human) IHC-P Human
Brcic I, Igrec J, Halbwedl I Et al. Expanding the spectrum of PLAG1-rearranged lipoblastomas arising in patients over 45, with identification of novel fusion partners Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2021-08-16 [PMID: 34400796]
Keiko S, Shintaro S, Tomoyuki A et al. Myoepithelioma of soft tissue and bone, and myoepithelioma-like tumors of the vulvar region: Clinicopathological study of 15 cases by PLAG1 immunohistochemistry. Pathol Int. 2020-09-17 [PMID: 32940946]
Goto Y, Ibi M, Sato H et al. PLAG1 enhances the stemness profiles of acinar cells in normal human salivary glands in a cell type-specific manner. J Oral Biosci. 2020-01-30 [PMID: 32007659]
Sakai H, Fujii Y, Kuwayama N et al. Plag1 regulates neuronal gene expression and neuronal differentiation of neocortical neural progenitor cells. Genes Cells. 2019-10-15 [PMID: 31442350]
Giovacchini F, Bensi C, Belli S et al. Low-grade intraductal carcinoma of salivary glands: A systematic review of this rare entity. J Oral Biol Craniofac Res. 2018-11-25 [PMID: 30555776]
Show All 19 Publications.

Reviews for PLAG1 Antibody (H00005324-M02) (0)

There are no reviews for PLAG1 Antibody (H00005324-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLAG1 Antibody (H00005324-M02). (Showing 1 - 1 of 1 FAQs).

  1. Could you help confirm whether we have the recommendation dilution ration for WB and IHC of H00005324-M02?
    • This is a product from Abnova and they recommend their mouse monoclonal antibodies for WB at 1 - 5 ug/ml for 25 - 50 ug of cell lysate/lane. The IHC validation of this antibody is recommended based on Bahrami et al's publication (Head Neck Pathol. 2012 Sep; 6(3): 328–335, PMID: 22485045) and in this paper, the author's team used this antibody at 1: 50 dilution. 

Secondary Antibodies

 

Isotype Controls

Additional PLAG1 Products

Research Areas for PLAG1 Antibody (H00005324-M02)

Find related products by research area.

Blogs on PLAG1

There are no specific blogs for PLAG1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAG1 Antibody (3B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAG1
Entrez
OMIM
Uniprot