PLAG1 Antibody (3B7)

Images

 
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa).
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
3B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLAG1 Antibody (3B7) Summary

Immunogen
PLAG1 (NP_002646, 2 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLAG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC usage was reported in scientific literature.
Publications
Read Publications using
H00005324-M02 in the following applications:

  • IHC
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLAG1 Antibody (3B7)

  • COL1A2/PLAG1 fusion
  • Pleiomorphic adenoma gene 1 protein
  • pleiomorphic adenoma gene 1
  • SGPA
  • zinc finger protein PLAG1
  • ZNF912

Background

Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC

Publications for PLAG1 Antibody (H00005324-M02)(5)

Reviews for PLAG1 Antibody (H00005324-M02) (0)

There are no reviews for PLAG1 Antibody (H00005324-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLAG1 Antibody (H00005324-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLAG1 Products

Bioinformatics Tool for PLAG1 Antibody (H00005324-M02)

Discover related pathways, diseases and genes to PLAG1 Antibody (H00005324-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLAG1 Antibody (H00005324-M02)

Discover more about diseases related to PLAG1 Antibody (H00005324-M02).
 

Pathways for PLAG1 Antibody (H00005324-M02)

View related products by pathway.

PTMs for PLAG1 Antibody (H00005324-M02)

Learn more about PTMs related to PLAG1 Antibody (H00005324-M02).

Blogs on PLAG1

There are no specific blogs for PLAG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAG1 Antibody (3B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAG1
Entrez
OMIM
Uniprot