PLAG1 Antibody (3B7)

Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa) .

Immunohistochemistry: PLAG1 Antibody (3B7) [H00005324-M02] - Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5mm) and enlargement of selected areas (lower panels, scale bars=100um). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 positive vs. negative tumors. P (high TGFBR3)=0.002, Fisher's exact test. n=5+34. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-017-01178-z), licensed under a CC-BY licence.

ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC, IHC-P
• Clone: 3B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

PLAG1 Antibody (3B7) Summary

• Immunogen: PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLAG1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC usage was reported in scientific literature.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLAG1 Antibody (3B7)

• COL1A2/PLAG1 fusion
• Pleiomorphic adenoma gene 1 protein
• pleiomorphic adenoma gene 1
• SGPA
• zinc finger protein PLAG1
• ZNF912

Background

Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLAG1 Antibody (H00005324-M02)(11)

Publications using H00005324-M02

• Yoon YJ, Kim D, Tak KY et al. Salivary gland organoid culture maintains distinct glandular properties of murine and human major salivary glands Nature communications 2022-06-07 [PMID: 35672412] (IF/IHC, Human)
• Gerhard-Hartmann E, Vokuhl C, Roth S Et al. The histological and molecular spectrum of lipoblastoma: A case series with identification of three novel gene fusions by targeted RNA-sequencing Pathology, research and practice 2021-08-18 [PMID: 34455363] (IHC-P, Human)
• Brcic I, Igrec J, Halbwedl I Et al. Expanding the spectrum of PLAG1-rearranged lipoblastomas arising in patients over 45, with identification of novel fusion partners Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2021-08-16 [PMID: 34400796]
• Arias-Stella JA, Benayed R, Oliva E et al. Novel PLAG1 Gene Rearrangement Distinguishes a Subset of Uterine Myxoid Leiomyosarcoma From Other Uterine Myxoid Mesenchymal Tumors Am. J. Surg. Pathol. 2019-03-01 [PMID: 30489320] (IHC-P, Human)
• Lee JH, Kang HJ, Yoo CW et al. PLAG1, SOX10, and Myb Expression in Benign and Malignant Salivary Gland Neoplasms. J Pathol Transl Med. 2018-11-14 [PMID: 30424592] (Human)
• Andreasen S, von Holstein SL, Homoe P, Heegaard S. Recurrent rearrangements of the PLAG1 and HMGA2 genes in lacrimal gland pleomorphic adenoma and carcinoma ex pleomorphic adenoma. Acta Ophthalmol. 2018-02-13 [PMID: 29437290] (Human)
• Jung SH, Choi HJ, Shin MG et al. Thalidomide-based induction regimens are as effective as bortezomib-based regimens in elderly patients with multiple myeloma with cereblon expression Ann. Hematol. 2016-07-01 [PMID: 27365142] (IF/IHC, Human)
• Bahrami A, Dalton JD, Shivakumar B, Krane JF. PLAG1 Alteration in Carcinoma Ex Pleomorphic Adenoma: Immunohistochemical and Fluorescence In Situ Hybridization Studies of 22 Cases. Head Neck Pathol. 2012-04-08 [PMID: 22485045] (IF/IHC, Human)
• Bahrami A, Dalton JD, Bangalore S, Henry C, Krane JF, Navid F, Ellison DW. Disseminated Carcinoma Ex Pleomorphic Adenoma in an Adolescent Confirmed by Application of PLAG1 Immunohistochemistry and FISH for PLAG1 Rearrangement. Head Neck Pathol. 2012-02-02 [PMID: 22297681]
• Bahrami A, Dalton JD, Krane JF, Fletcher CDM. A subset of cutaneous and soft tissue mixed tumors are genetically linked to their salivary gland counterpart. Genes, Chromosomes & Cancer. 2011-10-28 [PMID: 22038920]
• Pallasch CP, Patz M, Park YJ et al. miRNA deregulation by epigenetic silencing disrupts suppression of the oncogene PLAG1 in chronic lymphocytic leukemia. Blood 114(15):3255-64. 2009-10-08 [PMID: 19692702]

FAQs for PLAG1 Antibody (H00005324-M02). (Showing 1 - 1 of 1 FAQs).

1. Could you help confirm whether we have the recommendation dilution ration for WB and IHC of H00005324-M02?
   • This is a product from Abnova and they recommend their mouse monoclonal antibodies for WB at 1 - 5 ug/ml for 25 - 50 ug of cell lysate/lane. The IHC validation of this antibody is recommended based on Bahrami et al's publication (Head Neck Pathol. 2012 Sep; 6(3): 328–335, PMID: 22485045) and in this paper, the author's team used this antibody at 1: 50 dilution. 

Bioinformatics

• Gene Symbol: PLAG1
• Entrez:
  • 5324(Human)
• OMIM:
  • 181030(Human)
• Uniprot:
  • NP_002646(Human)