Home » alcohol dehydrogenase 4 » alcohol dehydrogenase 4 Research Products » alcohol dehydrogenase 4 Antibody

alcohol dehydrogenase 4 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are ...read more
Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

alcohol dehydrogenase 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
alcohol dehydrogenase 4 Protein (NBP1-90233PEP)
Publications
Read Publication using NBP1-90233.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 4 Antibody

  • ADH-2
  • alcohol dehydrogenase 4 (class II), pi polypeptide
  • alcohol dehydrogenase 4
  • Alcohol dehydrogenase class II pi chain
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Amphiregulin
[Biotin]
DY262
(1 Review)
(37 Publications)
Species: Hu
Applications: ELISA
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Flow Cytometry: AKR1A1 Antibody (6E3) [NBP2-02164] - Analysis of Hela cells, using anti-AKR1A1 antibody, (Red) compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: AKR1A1 Antibody (6E3) [NBP2-02164] - Analysis of Jurkat cells, using anti-AKR1A1 antibody, (Red) compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: AKR1A1 Antibody (6E3) [NBP2-02164] - HEK293T cells transfected with either pCMV6-ENTRY AKR1A1.(Red) or empty vector control plasmid (Blue) were immunostained with anti-AKR1A1 mouse monoclonal, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Sorbitol
Dehydrogenase Antibod
NBP1-87416
Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis using Anti-SORD antibody NBP1-87416 (A) shows similar pattern to independent antibody NBP1-87415 (B).
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Staining of human kidney, liver, prostate and skeletal muscle using Anti-SORD antibody NBP1-87416 (A) shows similar protein distribution across tissues to independent antibody NBP1-87415 (B).
Immunohistochemistry-Paraffin: Sorbitol Dehydrogenase Antibody [NBP1-87416] - Analysis in human prostate and skeletal muscle tissues using NBP1-87416 antibody. Corresponding SORD RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Neurophysin
II/Arg-vasopressin An ...
AF009
Neurophysin II was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Neurophysin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF009) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell cytoplasm. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: IHC, WB
Aldo-keto
Reductase 1B10/AKR1B1 ...
H00057016-M01
ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.1ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
(13 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
ARIH1 Antibody
NB100-1162
Western Blot: ARIH1 Antibody [NB100-1162] - (0.5ug/ml) of U937 lysate (RIPA buffer, 30ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry-Paraffin: ARIH1 Antibody [NB100-1162] - staining of paraffin embedded Human Adrenal Gland. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
DCXR Antibody
(OTI7D11)
NBP2-02192
Western Blot: DCXR Antibody (7D11) [NBP2-02192] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DCXR (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DCXR.
Immunohistochemistry-Paraffin: DCXR Antibody (7D11) [NBP2-02192] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-DCXR mouse monoclonal antibody.
Immunohistochemistry-Paraffin: DCXR Antibody (7D11) [NBP2-02192] - Staining of paraffin-embedded Carcinoma of liver tissue using anti-DCXR mouse monoclonal antibody.
Species: Hu
Applications: IHC, IHC-P, WB
XPR1 Antibody
NBP2-48531
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Fallopian tube shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Testis shows strong membranous and cytoplasmic positivity in spermatogonia and cells in seminiferous ducts.
Species: Hu
Applications: IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ST3GAL4 Antibody
NBP1-69565
Immunohistochemistry: ST3GAL4 Antibody [NBP1-69565] - Human Liver cells.
Western Blot: ST3GAL4 Antibody [NBP1-69565] - This Anti-ST3GAL4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Albumin Antibody -
BSA Free
NB600-41532
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. WB image submitted by a verified customer review.
(41 Publications)
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(4 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AKR7A2 Antibody
NBP1-32828
Immunohistochemistry-Paraffin: AKR7A2 Antibody [NBP1-32828] - AKR7A2 Antibody detects AKR7A2 protein at cytoplasm on mouse fore brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse fore brain. AKR7A2 Antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: AKR7A2 Antibody [NBP1-32828] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: AKR7A2 Antibody [NBP1-32828] - Sample (30 ug of whole cell lysate) A: A431 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA/CF
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(702 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
alcohol
dehydrogenase 4 Antib
NBP1-90233
alcohol dehydrogenase 4 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for alcohol dehydrogenase 4 Antibody (NBP1-90233)(1)


Reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)

There are no reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alcohol dehydrogenase 4 Products

Bioinformatics Tool for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Discover related pathways, diseases and genes to alcohol dehydrogenase 4 Antibody (NBP1-90233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Discover more about diseases related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
 

Pathways for alcohol dehydrogenase 4 Antibody (NBP1-90233)

View related products by pathway.

PTMs for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Learn more about PTMs related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
 

Research Areas for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Find related products by research area.

Blogs on alcohol dehydrogenase 4

There are no specific blogs for alcohol dehydrogenase 4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ADH4
Entrez
Uniprot