alcohol dehydrogenase 4 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ADH4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Theoretical MW |
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 24309898)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for alcohol dehydrogenase 4 Antibody
Background
alcohol dehydrogenase 4 encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: WB, IHC, IHC-P
Publications for alcohol dehydrogenase 4 Antibody (NBP1-90233)(1)
Showing Publication 1 -
1 of 1.
Reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)
There are no reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alcohol dehydrogenase 4 Products
Bioinformatics Tool for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Discover related pathways, diseases and genes to alcohol dehydrogenase 4 Antibody (NBP1-90233). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Discover more about diseases related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
| | Pathways for alcohol dehydrogenase 4 Antibody (NBP1-90233)
View related products by pathway.
|
PTMs for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Learn more about PTMs related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
| | Research Areas for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Find related products by research area.
|
Blogs on alcohol dehydrogenase 4