alcohol dehydrogenase 4 Antibody

Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

alcohol dehydrogenase 4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
• Specificity: Specificity of human alcohol dehydrogenase 4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADH4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 4 Antibody

• ADH-2
• alcohol dehydrogenase 4 (class II), pi polypeptide
• alcohol dehydrogenase 4
• Alcohol dehydrogenase class II pi chain
• aldehyde reductase
• EC 1.1.1
• EC 1.1.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alcohol dehydrogenase 4 Antibody (NBP1-90233)(1)

Publication using NBP1-90233

• Fagerberg L, Hallstrom BM, Oksvold P et al. Analysis of the Human Tissue-specific Expression by Genome-wide Integration of Transcriptomics and Antibody-based Proteomics. Mol Cell Proteomics 2014 Feb [PMID: 24309898]

Bioinformatics

• Gene Symbol: ADH4
• Entrez:
  • 127(Human)
• Uniprot:
  • P08319(Human)