alcohol dehydrogenase 4 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ADH4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Theoretical MW |
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 24309898)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for alcohol dehydrogenase 4 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC, IHC-P
Publications for alcohol dehydrogenase 4 Antibody (NBP1-90233)(1)
Showing Publication 1 -
1 of 1.
Reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)
There are no reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alcohol dehydrogenase 4 Products
Bioinformatics Tool for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Discover related pathways, diseases and genes to alcohol dehydrogenase 4 Antibody (NBP1-90233). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Discover more about diseases related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
| | Pathways for alcohol dehydrogenase 4 Antibody (NBP1-90233)
View related products by pathway.
|
PTMs for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Learn more about PTMs related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
| | Research Areas for alcohol dehydrogenase 4 Antibody (NBP1-90233)
Find related products by research area.
|
Blogs on alcohol dehydrogenase 4