alcohol dehydrogenase 4 Antibody - BSA Free

Analysis in human liver and tonsil tissues using NBP1-90233 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Staining of human tonsil shows no positivity in germinal center cells as expected.

Staining of human fallopian tube shows no positivity in glandular cells as expected.

Staining of human duodenum shows strong cytoplasmic positivity in endocrine glandular cells.

Analysis in human liver tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alcohol dehydrogenase 4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit alcohol dehydrogenase 4 Antibody - BSA Free (NBP1-90233) is a polyclonal antibody validated for use in IHC and WB. Anti-alcohol dehydrogenase 4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADH4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alcohol dehydrogenase 4 Antibody - BSA Free

• ADH-2
• alcohol dehydrogenase 4 (class II), pi polypeptide
• alcohol dehydrogenase 4
• Alcohol dehydrogenase class II pi chain
• aldehyde reductase
• EC 1.1.1
• EC 1.1.1.1

Background

alcohol dehydrogenase 4 encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alcohol dehydrogenase 4 Antibody (NBP1-90233)(1)

Publication using NBP1-90233

• Fagerberg L, Hallstrom BM, Oksvold P et al. Analysis of the Human Tissue-specific Expression by Genome-wide Integration of Transcriptomics and Antibody-based Proteomics. Mol Cell Proteomics 2014-02-01 [PMID: 24309898]

Bioinformatics

• Gene Symbol: ADH4
• Entrez:
  • 127(Human)
• Uniprot:
  • P08319(Human)