alcohol dehydrogenase 4 Antibody

Images

 
Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

alcohol dehydrogenase 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
Specificity
Specificity of human alcohol dehydrogenase 4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
alcohol dehydrogenase 4 Protein (NBP1-90233PEP)
Publications
Read Publication using NBP1-90233.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alcohol dehydrogenase 4 Antibody

  • ADH-2
  • alcohol dehydrogenase 4 (class II), pi polypeptide
  • alcohol dehydrogenase 4
  • Alcohol dehydrogenase class II pi chain
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32828
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for alcohol dehydrogenase 4 Antibody (NBP1-90233)(1)

Reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)

There are no reviews for alcohol dehydrogenase 4 Antibody (NBP1-90233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 4 Antibody (NBP1-90233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alcohol dehydrogenase 4 Products

Bioinformatics Tool for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Discover related pathways, diseases and genes to alcohol dehydrogenase 4 Antibody (NBP1-90233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Discover more about diseases related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
 

Pathways for alcohol dehydrogenase 4 Antibody (NBP1-90233)

View related products by pathway.

PTMs for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Learn more about PTMs related to alcohol dehydrogenase 4 Antibody (NBP1-90233).
 

Research Areas for alcohol dehydrogenase 4 Antibody (NBP1-90233)

Find related products by research area.

Blogs on alcohol dehydrogenase 4

There are no specific blogs for alcohol dehydrogenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH4
Entrez
Uniprot