alcohol dehydrogenase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] - Immunofluorescence analysis of paraffin-embedded Mouse liver using alcohol dehydrogenase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: alcohol dehydrogenase Antibody [NBP3-35880] - Western blot analysis of lysates from Mouse lung, using alcohol dehydrogenase Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] - Immunofluorescence analysis of paraffin-embedded Rat liver using alcohol dehydrogenase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] - Immunofluorescence analysis of paraffin-embedded Human liver using alcohol dehydrogenase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alcohol dehydrogenase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit alcohol dehydrogenase Antibody - BSA Free (NBP3-35880) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 270-370 of human alcohol dehydrogenase (NP_000659.2).
  
  Sequence:
  LLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADH1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for alcohol dehydrogenase Antibody - BSA Free

• ADH, alpha subunit
• ADH1alcohol dehydrogenase 1A
• alcohol dehydrogenase 1 (class I), alpha polypeptide
• alcohol dehydrogenase 1A (class I), alpha polypeptide
• Alcohol dehydrogenase subunit alpha
• aldehyde reductase
• EC 1.1.1
• EC 1.1.1.1

Background

ADH (alcohol dehydrogenase) family of proteins metabolize a variety of substances such as ethanol, retinal, other aliphatic alcohol, hydroxysteroids, and lipid peroxidation products. With the coenzyme NAD, ADH catalyzes the reversible conversion of organic alcohol to ketones or aldehydes. ADH play a major role in ethanol metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADH1A