AIF-1/Iba1 Antibody (2A2-B6)

Images

 
Western Blot: AIF-1/Iba1 Antibody (2A2-B6) [H00000199-M01] - AIF1 monoclonal antibody (M01), clone 2A2-B6 Analysis of AIF1 expression in K-562.
ELISA: AIF-1/Iba1 Antibody (2A2-B6) [H00000199-M01] - Detection limit for recombinant GST tagged AIF1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A2-B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AIF-1/Iba1 Antibody (2A2-B6) Summary

Immunogen
AIF1 (AAH09474.1, 1 a.a. - 147 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP
Marker
pan-Microglia Marker
Specificity
AIF1 - allograft inflammatory factor 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AIF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00000199-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AIF-1/Iba1 Antibody (2A2-B6)

  • AIF1
  • AIF-1
  • AIF-1IRT1
  • allograft inflammatory factor 1
  • G1
  • IBA1
  • IBA1Em:AF129756.17
  • IbaI
  • interferon gamma responsive transcript
  • Ionized calcium-binding adapter molecule 1
  • IRT1
  • IRT-1
  • Protein G1

Background

This gene is induced by cytokines and interferon. Its protein product is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. The gene expresses two transcripts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for AIF-1/Iba1 Antibody (H00000199-M01)(1)

Reviews for AIF-1/Iba1 Antibody (H00000199-M01) (0)

There are no reviews for AIF-1/Iba1 Antibody (H00000199-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIF-1/Iba1 Antibody (H00000199-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIF-1/Iba1 Products

Bioinformatics Tool for AIF-1/Iba1 Antibody (H00000199-M01)

Discover related pathways, diseases and genes to AIF-1/Iba1 Antibody (H00000199-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIF-1/Iba1 Antibody (H00000199-M01)

Discover more about diseases related to AIF-1/Iba1 Antibody (H00000199-M01).
 

Pathways for AIF-1/Iba1 Antibody (H00000199-M01)

View related products by pathway.

PTMs for AIF-1/Iba1 Antibody (H00000199-M01)

Learn more about PTMs related to AIF-1/Iba1 Antibody (H00000199-M01).
 

Research Areas for AIF-1/Iba1 Antibody (H00000199-M01)

Find related products by research area.

Blogs on AIF-1/Iba1

There are no specific blogs for AIF-1/Iba1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIF-1/Iba1 Antibody (2A2-B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol AIF1
Entrez
OMIM
Uniprot