Carbonic Anhydrase I/CA1 Antibody (7G12)

Images

 
Western Blot: Carbonic Anhydrase I/CA1 Antibody (7G12) [H00000759-M07] - Analysis of CA1 expression in human pancreas.
Western Blot: Carbonic Anhydrase I/CA1 Antibody (7G12) [H00000759-M07] - Analysis of CA1 expression in transfected 293T cell line by CA1 monoclonal antibody (M07), clone 7G12. Lane 1: CA1 transfected lysatE (28.9 KDa). ...read more
ELISA: Carbonic Anhydrase I/CA1 Antibody (7G12) [H00000759-M07] - Detection limit for recombinant GST tagged CA1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Carbonic Anhydrase I/CA1 Antibody (7G12) Summary

Immunogen
CA1 (AAH27890, 1 a.a. - 261 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Specificity
carbonic anhydrase I
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against tissue lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Carbonic Anhydrase I/CA1 Antibody (7G12)

  • CA1
  • CA-I
  • Car1
  • Carbonate dehydratase I
  • carbonic anhydrase 1
  • Carbonic anhydrase B
  • Carbonic Anhydrase I
  • carbonic anhydrase ICAB
  • carbonic dehydratase
  • EC 4.2.1.1

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB2186
Species: Hu
Applications: WB, IHC, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000759-M07
Species: Hu
Applications: WB, ELISA

Publications for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07) (0)

There are no publications for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07) (0)

There are no reviews for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbonic Anhydrase I/CA1 Products

Bioinformatics Tool for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07)

Discover related pathways, diseases and genes to Carbonic Anhydrase I/CA1 Antibody (H00000759-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07)

Discover more about diseases related to Carbonic Anhydrase I/CA1 Antibody (H00000759-M07).
 

Pathways for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07)

View related products by pathway.

PTMs for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07)

Learn more about PTMs related to Carbonic Anhydrase I/CA1 Antibody (H00000759-M07).
 

Research Areas for Carbonic Anhydrase I/CA1 Antibody (H00000759-M07)

Find related products by research area.

Blogs on Carbonic Anhydrase I/CA1

There are no specific blogs for Carbonic Anhydrase I/CA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbonic Anhydrase I/CA1 Antibody (7G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CA1
Entrez
OMIM
Uniprot