AgRP/ART Antibody

Images

 
Immunohistochemistry-Paraffin: AgRP/ART Antibody [NBP1-89203] - Staining of human adrenal gland shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AgRP/ART Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM
Specificity
Specificity of human AgRP/ART antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AgRP/ART Protein (NBP1-89203PEP)
Publications
Read Publication using NBP1-89203.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AgRP/ART Antibody

  • agouti related protein homolog (mouse)
  • agouti-related protein
  • AgRP
  • Agrt
  • AGRTMGC118963
  • ART
  • ARTagouti (mouse) related protein
  • ASIP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB163
Species: Hu
Applications: WB, IHC
NB100-1501
Species: Hu
Applications: WB, PEP-ELISA
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00001392-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-89203
Species: Hu
Applications: IHC, IHC-P

Publications for AgRP/ART Antibody (NBP1-89203)(1)

Reviews for AgRP/ART Antibody (NBP1-89203) (0)

There are no reviews for AgRP/ART Antibody (NBP1-89203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AgRP/ART Antibody (NBP1-89203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AgRP/ART Products

Bioinformatics Tool for AgRP/ART Antibody (NBP1-89203)

Discover related pathways, diseases and genes to AgRP/ART Antibody (NBP1-89203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AgRP/ART Antibody (NBP1-89203)

Discover more about diseases related to AgRP/ART Antibody (NBP1-89203).
 

Pathways for AgRP/ART Antibody (NBP1-89203)

View related products by pathway.

PTMs for AgRP/ART Antibody (NBP1-89203)

Learn more about PTMs related to AgRP/ART Antibody (NBP1-89203).

Blogs on AgRP/ART

There are no specific blogs for AgRP/ART, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AgRP/ART Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGRP