ARC/ARG3.1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to ARC(activity-regulated cytoskeleton-associated protein) The peptide sequence was selected from the middle region of ARC. Peptide sequence ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ARC |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 5 ug/ml
- Western Blot 1.0 ug/ml
|
Application Notes |
This is a rabbit polyclonal antibody against ARC and was validated on Western blot. |
Theoretical MW |
45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS & 2% Sucrose. |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ARC/ARG3.1 Antibody
Background
ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC, IHC-P
Publications for ARC/ARG3.1 Antibody (NBP1-56929) (0)
There are no publications for ARC/ARG3.1 Antibody (NBP1-56929).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARC/ARG3.1 Antibody (NBP1-56929) (0)
There are no reviews for ARC/ARG3.1 Antibody (NBP1-56929).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ARC/ARG3.1 Antibody (NBP1-56929) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ARC/ARG3.1 Products
Bioinformatics Tool for ARC/ARG3.1 Antibody (NBP1-56929)
Discover related pathways, diseases and genes to ARC/ARG3.1 Antibody (NBP1-56929). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ARC/ARG3.1 Antibody (NBP1-56929)
Discover more about diseases related to ARC/ARG3.1 Antibody (NBP1-56929).
| | Pathways for ARC/ARG3.1 Antibody (NBP1-56929)
View related products by pathway.
|
PTMs for ARC/ARG3.1 Antibody (NBP1-56929)
Learn more about PTMs related to ARC/ARG3.1 Antibody (NBP1-56929).
| | Research Areas for ARC/ARG3.1 Antibody (NBP1-56929)
Find related products by research area.
|
Blogs on ARC/ARG3.1