Home » ARC/ARG3.1 » ARC/ARG3.1 Antibodies » ARC/ARG3.1 Antibody

ARC/ARG3.1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T
Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929] - Human adrenal tissue at an antibody concentration of 5ug/ml.
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Hela, Antibody Dilution: 1.0 ug/ml.
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARC/ARG3.1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARC(activity-regulated cytoskeleton-associated protein) The peptide sequence was selected from the middle region of ARC. Peptide sequence ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARC and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARC/ARG3.1 Antibody

  • activity-regulated cytoskeleton-associated protein
  • ARC/ARG3.1
  • KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog

Background

ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry: Neuropeptide Y Antibody [NBP1-46535] - Low magnification images showing the double staining pattern of NHE1 with neuropeptide NPY. Scale bar: 100um. Insets: High magnification images showing individual cells with double staining. Scale bar: 10um. Asterisks mark Hoechst-stained nuclei. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-019-42872-w), licensed under a CC-BY licence.
(13 Publications)
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
BDNF [HRP]
DBD00
(4 Reviews)
(82 Publications)
Species: Hu
Applications: ELISA
Leptin/OB [HRP]
DLP00
(8 Reviews)
(132 Publications)
Species: Hu
Applications: ELISA
EGR1 Antibody (6E8)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysatE (59.73 KDa). Lane 2: Non-transfected lysate.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in Raw 264.7.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
(2 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot: GRIP1 Antibody [NBP2-41211] - Analysis of GRIP1 in 293 cell lysate with GRIP1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunofluorescence: GRIP1 Antibody [NBP2-41211] - Immunofluorescence of GRIP1 in rat brain tissue with GRIP1 antibody at 20 ug/ml.
Immunohistochemistry: GRIP1 Antibody [NBP2-41211] - Immunohistochemistry of GRIP1 in rat brain tissue with GRIP1 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
AgRP/ART [HRP]
DAGR00
(1 Review)
(3 Publications)
Species: Hu
Applications: ELISA
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
CART/CARTPT
Antibody (113612)
MAB163
CART/CARTPT Antibody (113612)
(5 Publications)
Species: Hu
Applications: IHC, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
GHRH Antibody
NBP3-04850
Western Blot: GHRH Antibody [NBP3-04850] - Western blot analysis of extracts of various cell lines, using GHRH antibody (NBP3-04850) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: WB
Neurotensin
Antibody
NBP2-33903
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Species: Hu
Applications: IHC, IHC-P
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(40 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
KISS1 Antibody
(1F7)
H00003814-M05
Western Blot: KISS1 Antibody (1F7) [H00003814-M05] - Analysis of KISS1 expression in transfected 293T cell line by KISS1 monoclonal antibody (M05), clone 1F7. Lane 1: KISS1 transfected lysatE (14.7 KDa). Lane 2: Non-transfected lysate.
ELISA: KISS1 Antibody (1F7) [H00003814-M05] - Detection limit for recombinant GST tagged KISS1 is approximately 0.3ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: KISS1 Antibody (1F7) [H00003814-M05] - Analysis of monoclonal antibody to KISS1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
(7 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
ARC/ARG3.1 Antibody
NBP1-56929
ARC/ARG3.1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARC/ARG3.1 Antibody (NBP1-56929) (0)

There are no publications for ARC/ARG3.1 Antibody (NBP1-56929).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARC/ARG3.1 Antibody (NBP1-56929) (0)

There are no reviews for ARC/ARG3.1 Antibody (NBP1-56929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARC/ARG3.1 Antibody (NBP1-56929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARC/ARG3.1 Products

Bioinformatics Tool for ARC/ARG3.1 Antibody (NBP1-56929)

Discover related pathways, diseases and genes to ARC/ARG3.1 Antibody (NBP1-56929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARC/ARG3.1 Antibody (NBP1-56929)

Discover more about diseases related to ARC/ARG3.1 Antibody (NBP1-56929).
 

Pathways for ARC/ARG3.1 Antibody (NBP1-56929)

View related products by pathway.

PTMs for ARC/ARG3.1 Antibody (NBP1-56929)

Learn more about PTMs related to ARC/ARG3.1 Antibody (NBP1-56929).
 

Research Areas for ARC/ARG3.1 Antibody (NBP1-56929)

Find related products by research area.

Blogs on ARC/ARG3.1

There are no specific blogs for ARC/ARG3.1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARC/ARG3.1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARC
Uniprot