ARC/ARG3.1 Antibody

Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T

Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929] - Human adrenal tissue at an antibody concentration of 5ug/ml.

Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.

Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Hela, Antibody Dilution: 1.0 ug/ml.

Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARC/ARG3.1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ARC(activity-regulated cytoskeleton-associated protein) The peptide sequence was selected from the middle region of ARC. Peptide sequence ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ARC and was validated on Western blot.
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARC/ARG3.1 Antibody

• activity-regulated cytoskeleton-associated protein
• ARC/ARG3.1
• KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog

Background

ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARC
• Uniprot:
  • Q7LC44(Human)