ARC/ARG3.1 Antibody

Images

 
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T
Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929] - Human adrenal tissue at an antibody concentration of 5ug/ml.
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Hela, Antibody Dilution: 1.0 ug/ml.
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARC/ARG3.1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARC(activity-regulated cytoskeleton-associated protein) The peptide sequence was selected from the middle region of ARC. Peptide sequence ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARC and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARC/ARG3.1 Antibody

  • activity-regulated cytoskeleton-associated protein
  • ARC/ARG3.1
  • KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog

Background

ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91749
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-45672
Species: Hu, Mu, Rt
Applications: WB
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARC/ARG3.1 Antibody (NBP1-56929) (0)

There are no publications for ARC/ARG3.1 Antibody (NBP1-56929).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARC/ARG3.1 Antibody (NBP1-56929) (0)

There are no reviews for ARC/ARG3.1 Antibody (NBP1-56929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARC/ARG3.1 Antibody (NBP1-56929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ARC/ARG3.1 Antibody (NBP1-56929)

Discover related pathways, diseases and genes to ARC/ARG3.1 Antibody (NBP1-56929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARC/ARG3.1 Antibody (NBP1-56929)

Discover more about diseases related to ARC/ARG3.1 Antibody (NBP1-56929).
 

Pathways for ARC/ARG3.1 Antibody (NBP1-56929)

View related products by pathway.

PTMs for ARC/ARG3.1 Antibody (NBP1-56929)

Learn more about PTMs related to ARC/ARG3.1 Antibody (NBP1-56929).
 

Research Areas for ARC/ARG3.1 Antibody (NBP1-56929)

Find related products by research area.

Blogs on ARC/ARG3.1

There are no specific blogs for ARC/ARG3.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARC/ARG3.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARC
Uniprot