![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T](http://images.novusbio.com/fullsize2/ARC-ARG3.1 Antibody-Western Blot-NBP1-56929-img0010.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T")
| Reactivity | Hu, Mu, Rt, Bv, Gt, GpSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to ARC(activity-regulated cytoskeleton-associated protein) The peptide sequence was selected from the middle region of ARC. Peptide sequence ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF. The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (100%), Rat (100%), Goat (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against ARC and was validated on Western blot. |
| Theoretical MW | 45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS & 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for ARC/ARG3.1 Antibody (NBP1-56929)Discover more about diseases related to ARC/ARG3.1 Antibody (NBP1-56929).
| Pathways for ARC/ARG3.1 Antibody (NBP1-56929)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929] - Human adrenal tissue at an antibody concentration of 5ug/ml.](http://images.novusbio.com/fullsize2/ARC-ARG3.1-Antibody-Immunohistochemistry-Paraffin-NBP1-56929-img0004.jpg "Immunohistochemistry-Paraffin: ARC/ARG3.1 Antibody [NBP1-56929] - Human adrenal tissue at an antibody concentration of 5ug/ml.")
![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0005.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.")
![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Hela, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0007.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Hela, Antibody Dilution: 1.0 ug/ml.")
![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize2/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0008.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml")
![Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize2/ARC-ARG3.1-Antibody-Western-Blot-NBP1-56929-img0009.jpg "Western Blot: ARC/ARG3.1 Antibody [NBP1-56929] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml")
![Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.](http://images.novusbio.com/images2/POMC-Antibody-Western-Blot-NB100-1533-img0005.jpg)
![Immunohistochemistry: POMC Antibody [NB100-1533] - Representative confocal images of POMC in POMC-transfected WT and Sel1L-/- N2a cells. White arrows point to POMC-containing secretory granules, while yellow arrows point to perinuclear POMC. KDEL marks the ER. Representative data from at least 2 independent experiments are shown. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.](http://images.novusbio.com/images2/POMC-Antibody-Immunohistochemistry-NB100-1533-img0008.jpg)
![Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/POMC-Antibody-Flow-Cytometry-NB100-1533-img0006.jpg)
![Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/images2/c-Fos-Antibody-(2H2)-Knockout-Validated-NBP2-50037-img0005.jpg)
![Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.](http://images.novusbio.com/images2/c-Fos-Antibody-(2H2)-Western-Blot-NBP2-50037-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.](http://images.novusbio.com/images2/c-Fos-Antibody-(2H2)-Immunocytochemistry-Immunofluorescence-NBP2-50037-img0006.jpg)
![Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Western-Blot-H00001958-M03-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Immunocytochemistry-Immunofluorescence-H00001958-M03-img0010.jpg)
![Immunohistochemistry-Paraffin: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/EGR1-Antibody-(6E8)-Immunohistochemistry-Paraffin-H00001958-M03-img0011.jpg)
![Western Blot: GRIP1 Antibody [NBP2-41211] - Analysis of GRIP1 in 293 cell lysate with GRIP1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.](http://images.novusbio.com/images2/GRIP1-Antibody-Western-Blot-NBP2-41211-img0004.jpg)
![Immunohistochemistry: GRIP1 Antibody [NBP2-41211] - Immunohistochemistry of GRIP1 in rat brain tissue with GRIP1 antibody at 2.5 ug/ml.](http://images.novusbio.com/images2/GRIP1-Antibody-Immunohistochemistry-NBP2-41211-img0002.jpg)
![Immunofluorescence: GRIP1 Antibody [NBP2-41211] - Immunofluorescence of GRIP1 in rat brain tissue with GRIP1 antibody at 20 ug/ml.](http://images.novusbio.com/images2/GRIP1-Antibody-Immunofluorescence-NBP2-41211-img0003.jpg)
![Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Western-Blot-NBP2-34260-img0006.jpg)
![Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-NBP2-34260-img0005.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.](http://images.novusbio.com/images2/PLOD1-Antibody-Western-Blot-NBP2-38770-img0007.jpg)
![Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.](http://images.novusbio.com/images2/PLOD1-Antibody-Western-Blot-NBP2-38770-img0005.jpg)
![Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.](http://images.novusbio.com/images2/PLOD1-Antibody-Western-Blot-NBP2-38770-img0006.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Western-Blot-NBP1-33736-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33736-img0009.jpg)
![Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunohistochemistry-Paraffin-NBP1-33736-img0007.jpg)
![Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Analysis in human small intestine and skeletal muscle tissues. Corresponding NTS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Neurotensin-Antibody-Immunohistochemistry-Paraffin-NBP2-33903-img0005.jpg)
![Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/images2/Neurotensin-Antibody-Immunohistochemistry-Paraffin-NBP2-33903-img0001.jpg)
![Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/images2/Neurotensin-Antibody-Immunohistochemistry-Paraffin-NBP2-33903-img0002.jpg)
![Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.](http://images.novusbio.com/images2/CD4-Antibody-Western-Blot-NBP1-19371-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/images2/CD4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-19371-img0005.jpg)
![Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.](http://images.novusbio.com/images2/CD4-Antibody-Immunohistochemistry-Paraffin-NBP1-19371-img0014.jpg)
![Western Blot: KISS1 Antibody (1F7) [H00003814-M05] - Analysis of KISS1 expression in transfected 293T cell line by KISS1 monoclonal antibody (M05), clone 1F7. Lane 1: KISS1 transfected lysatE (14.7 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/KISS1-Antibody-(1F7)-Western-Blot-H00003814-M05-img0004.jpg)
![Immunohistochemistry-Paraffin: KISS1 Antibody (1F7) [H00003814-M05] - Analysis of monoclonal antibody to KISS1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/KISS1-Antibody-(1F7)-Immunohistochemistry-Paraffin-H00003814-M05-img0003.jpg)
![ELISA: KISS1 Antibody (1F7) [H00003814-M05] - Detection limit for recombinant GST tagged KISS1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/KISS1-Antibody-(1F7)-ELISA-H00003814-M05-img0002.jpg)
![Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/CRAT-Antibody-Immunohistochemistry-Paraffin-NBP1-86616-img0014.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0011.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0010.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")