A20/TNFAIP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: A20/TNFAIP3 Antibody [NBP1-89337] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: A20/TNFAIP3 Antibody [NBP1-89337] - Staining of human lymph node shows cytoplasmic positivity in germinal center and non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

A20/TNFAIP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFAIP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
A20/TNFAIP3 Protein (NBP1-89337PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for A20/TNFAIP3 Antibody

  • A20
  • A20TNFA1P2
  • EC 3.4.19.12
  • EC 6.3.2.-
  • MGC104522
  • MGC138687
  • OTU domain-containing protein 7C
  • OTUD7C
  • OTUD7CMGC138688
  • Putative DNA-binding protein A20
  • TNF alpha-induced protein 3
  • TNFA1P2
  • TNFAIP3
  • tumor necrosis factor alpha-induced protein 3
  • tumor necrosis factor inducible protein A20
  • tumor necrosis factor, alpha-induced protein 3
  • Zinc finger protein A20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
796-IC
Species: Mu
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for A20/TNFAIP3 Antibody (NBP1-89337) (0)

There are no publications for A20/TNFAIP3 Antibody (NBP1-89337).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A20/TNFAIP3 Antibody (NBP1-89337) (0)

There are no reviews for A20/TNFAIP3 Antibody (NBP1-89337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for A20/TNFAIP3 Antibody (NBP1-89337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional A20/TNFAIP3 Products

Bioinformatics Tool for A20/TNFAIP3 Antibody (NBP1-89337)

Discover related pathways, diseases and genes to A20/TNFAIP3 Antibody (NBP1-89337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A20/TNFAIP3 Antibody (NBP1-89337)

Discover more about diseases related to A20/TNFAIP3 Antibody (NBP1-89337).
 

Pathways for A20/TNFAIP3 Antibody (NBP1-89337)

View related products by pathway.

PTMs for A20/TNFAIP3 Antibody (NBP1-89337)

Learn more about PTMs related to A20/TNFAIP3 Antibody (NBP1-89337).
 

Research Areas for A20/TNFAIP3 Antibody (NBP1-89337)

Find related products by research area.

Blogs on A20/TNFAIP3

There are no specific blogs for A20/TNFAIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our A20/TNFAIP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP3
Entrez