TNIP1 Antibody

Images

 
Genetic Strategies: Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Independent Antibodies: Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis using Anti-TNIP1 antibody NBP1-89306 (A) shows similar pattern to independent antibody NBP2-32705 (B).
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in human cell line A-431.
Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human Testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNIP1 Protein (NBP1-89306PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNIP1 Antibody

  • ABIN-1
  • HIV-1 Nef-interacting protein
  • hVAN
  • KIAA0113nip40-1
  • Naf1
  • NAF1TNFAIP3-interacting protein 1
  • Nef-associated factor 1 SNP
  • Nef-associated factor 1
  • Nip40-1
  • TNFAIP3 interacting protein 1
  • VANvirion-associated nuclear-shuttling protein
  • Virion-associated nuclear shuttling protein

Background

Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal . Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51911
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, PEP-ELISA, WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
236-EG
Species: Hu
Applications: BA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-77365
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP1-32689
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
1887-ML
Species: Mu
Applications: BA
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
AF4815
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, KD

Publications for TNIP1 Antibody (NBP1-89306) (0)

There are no publications for TNIP1 Antibody (NBP1-89306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIP1 Antibody (NBP1-89306) (0)

There are no reviews for TNIP1 Antibody (NBP1-89306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNIP1 Antibody (NBP1-89306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNIP1 Products

Diseases for TNIP1 Antibody (NBP1-89306)

Discover more about diseases related to TNIP1 Antibody (NBP1-89306).
 

Pathways for TNIP1 Antibody (NBP1-89306)

View related products by pathway.

PTMs for TNIP1 Antibody (NBP1-89306)

Learn more about PTMs related to TNIP1 Antibody (NBP1-89306).
 

Research Areas for TNIP1 Antibody (NBP1-89306)

Find related products by research area.

Blogs on TNIP1

There are no specific blogs for TNIP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNIP1