TNIP1 Antibody

Images

 
Genetic Strategies: Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in human cell line A-431.
Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

TNIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
Specificity
Specificity of human TNIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
TNIP1 Knockout HeLa Cell Lysate
Control Peptide
TNIP1 Protein (NBP1-89306PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNIP1 Antibody

  • ABIN-1
  • HIV-1 Nef-interacting protein
  • hVAN
  • KIAA0113nip40-1
  • Naf1
  • NAF1TNFAIP3-interacting protein 1
  • Nef-associated factor 1 SNP
  • Nef-associated factor 1
  • Nip40-1
  • TNFAIP3 interacting protein 1
  • VANvirion-associated nuclear-shuttling protein
  • Virion-associated nuclear shuttling protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA, ChIP
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-77365
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for TNIP1 Antibody (NBP1-89306) (0)

There are no publications for TNIP1 Antibody (NBP1-89306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIP1 Antibody (NBP1-89306) (0)

There are no reviews for TNIP1 Antibody (NBP1-89306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNIP1 Antibody (NBP1-89306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TNIP1 Products

Bioinformatics Tool for TNIP1 Antibody (NBP1-89306)

Discover related pathways, diseases and genes to TNIP1 Antibody (NBP1-89306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNIP1 Antibody (NBP1-89306)

Discover more about diseases related to TNIP1 Antibody (NBP1-89306).
 

Pathways for TNIP1 Antibody (NBP1-89306)

View related products by pathway.

PTMs for TNIP1 Antibody (NBP1-89306)

Learn more about PTMs related to TNIP1 Antibody (NBP1-89306).

Blogs on TNIP1

There are no specific blogs for TNIP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNIP1