TNIP1 Antibody - BSA Free

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis using Anti-TNIP1 antibody NBP1-89306 (A) shows similar pattern to independent antibody NBP2-32705 (B).

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in human cell line A-431.

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human Testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TNIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TNIP1 Antibody - BSA Free (NBP1-89306) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TNIP1 Protein (NBP1-89306PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TNIP1 Antibody - BSA Free

• ABIN-1
• HIV-1 Nef-interacting protein
• hVAN
• KIAA0113nip40-1
• Naf1
• NAF1TNFAIP3-interacting protein 1
• Nef-associated factor 1 SNP
• Nef-associated factor 1
• Nip40-1
• TNFAIP3 interacting protein 1
• VANvirion-associated nuclear-shuttling protein
• Virion-associated nuclear shuttling protein

Background

Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal . Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNIP1