TMTC2 Antibody - BSA Free

Western Blot: TMTC2 Antibody [NBP1-85027] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunocytochemistry/Immunofluorescence: TMTC2 Antibody [NBP1-85027] - Staining of human cell line U-251 MG shows localization to plasma membrane & actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TMTC2 Antibody [NBP1-85027] - Staining of human cerebral cortex shows strong cytoplasmic positivity in blood vessels.

Western Blot: TMTC2 Antibody [NBP1-85027] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: TMTC2 Antibody [NBP1-85027] - Staining of human fallopian tube shows strong cytoplasmic positivity in stromal cells.

Immunohistochemistry-Paraffin: TMTC2 Antibody [NBP1-85027] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: TMTC2 Antibody [NBP1-85027] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMTC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMTC2 Antibody - BSA Free (NBP1-85027) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLFLKAIELDPTKGNCYMHYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDLAARLRPNYPAALMNLGAIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMTC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMTC2 Protein (NBP1-85027PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMTC2 Antibody - BSA Free

• DKFZp762A217
• transmembrane and tetratricopeptide repeat containing 2
• transmembrane and TPR repeat-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for TMTC2 Antibody (NBP1-85027). (Showing 1 - 1 of 1 FAQ).

1. Does the WB image mean RT-4 and U251 have endogenous TMTC2 expression?
   • Yes, these cell lines have endogenous expression of TMTC2. Expression data for this protein in multiple cell lines can be found on The Human Protein Atlas website.

Bioinformatics

• Gene Symbol: TMTC2