XPD Antibody


Immunocytochemistry/ Immunofluorescence: XPD Antibody [NBP2-56327] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

XPD Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK
Specificity of human XPD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for XPD Antibody

  • Basic transcription factor 2 80 kDa subunit
  • BTF2 p80
  • COFS2
  • CXPD
  • DNA excision repair protein ERCC-2
  • DNA repair protein complementing XP-D cells
  • EC 3.6.1
  • EC
  • EM9
  • EM9TFIIH basal transcription factor complex 80 kDa subunit
  • ERCC2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 2
  • MAG
  • MGC102762
  • MGC126218
  • MGC126219
  • TFIIH 80 kDa subunit
  • TFIIH basal transcription factor complex helicase subunit
  • TFIIH basal transcription factor complex helicase XPD subunit
  • TTD
  • xeroderma pigmentosum complementary group D
  • Xeroderma pigmentosum group D-complementing protein
  • XPD
  • XPDC
  • XPDTFIIH p80


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF

Publications for XPD Antibody (NBP2-56327) (0)

There are no publications for XPD Antibody (NBP2-56327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPD Antibody (NBP2-56327) (0)

There are no reviews for XPD Antibody (NBP2-56327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for XPD Antibody (NBP2-56327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional XPD Products

Bioinformatics Tool for XPD Antibody (NBP2-56327)

Discover related pathways, diseases and genes to XPD Antibody (NBP2-56327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPD Antibody (NBP2-56327)

Discover more about diseases related to XPD Antibody (NBP2-56327).

Pathways for XPD Antibody (NBP2-56327)

View related products by pathway.

PTMs for XPD Antibody (NBP2-56327)

Learn more about PTMs related to XPD Antibody (NBP2-56327).

Research Areas for XPD Antibody (NBP2-56327)

Find related products by research area.

Blogs on XPD.

Using Aflatoxin B1 Antibody for Hepatocellular Carcinoma Studies
We at Novus Biologicals are constantly updating our antibody catalog in order to provide as comprehensive a database as possible for molecular biology researchers. Not all our antibodies are derived from proteins found in mammalian or human tissue. So...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XPD Antibody and receive a gift card or discount.


Gene Symbol ERCC2