GTF2H3 Antibody

Images

 
Western Blot: GTF2H3 Antibody [NBP2-87539] - WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:2500. Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be ...read more
Immunohistochemistry: GTF2H3 Antibody [NBP2-87539] - HumanMuscle
Immunohistochemistry-Paraffin: GTF2H3 Antibody [NBP2-87539] - Rabbit Anti-GTF2H3 antibody. Paraffin Embedded Tissue: Human Heart. Cellular Data: cardiac cell. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF2H3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human GTF2H3. Peptide sequence: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2H3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTF2H3 Antibody

  • Basic transcription factor 2 34 kDa subunit
  • BTF2 p34
  • BTF2
  • General transcription factor IIH polypeptide 3
  • general transcription factor IIH subunit 3
  • general transcription factor IIH, polypeptide 3 (34kD subunit)
  • general transcription factor IIH, polypeptide 3, 34kDa
  • TFB4
  • TFIIH basal transcription factor complex p34 subunit
  • TFIIH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
NBP2-67719
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GTF2H3 Antibody (NBP2-87539) (0)

There are no publications for GTF2H3 Antibody (NBP2-87539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H3 Antibody (NBP2-87539) (0)

There are no reviews for GTF2H3 Antibody (NBP2-87539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTF2H3 Antibody (NBP2-87539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTF2H3 Products

Bioinformatics Tool for GTF2H3 Antibody (NBP2-87539)

Discover related pathways, diseases and genes to GTF2H3 Antibody (NBP2-87539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H3 Antibody (NBP2-87539)

Discover more about diseases related to GTF2H3 Antibody (NBP2-87539).

Research Areas for GTF2H3 Antibody (NBP2-87539)

Find related products by research area.

Blogs on GTF2H3

There are no specific blogs for GTF2H3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2H3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H3