XRCC1 Antibody

Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented

Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.

Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

XRCC1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XRCC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  XRCC1 Protein (NBP1-87154PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for XRCC1 Antibody

• DNA repair protein XRCC1
• RCC
• X-ray repair complementing defective repair in Chinese hamster cells 1
• X-ray repair cross-complementing protein 1
• X-ray-repair, complementing defective, repair in Chinese hamster

Background

XRCC1 (X-ray cross complementing factor-1) is involved in DNA base excision repair. XRCC1 is a 70kDa protein that has been shown to be physically associated with other DNA repair enzymes, including poly (ADP-ribose) polymerase (PARP), DNA Ligase III and DNA polymerase beta. XRCC1 contains a BRCT domain (for BRCA1 carboxyl terminus) which was originally found in the tumor suppressor protein BRCA1. Recently, the BRCT domain has been shown to mediate the protein-protein interaction of XRCC1 and DNA Ligase III-a.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XRCC1 Antibody (NBP1-87154)(4)

Publications using NBP1-87154

• Bilkis R, Lake RJ, Cooper KL et al. The CSB chromatin remodeler regulates PARP1- and PARP2-mediated single-strand break repair at actively transcribed DNA regions Nucleic acids research 2023-06-16 [PMID: 37326017] (WB, Human)
• Demin A, Hirota K, Tsuda M et al. XRCC1 Prevents Toxic PARP1 Trapping During DNA Base Excision Repair Mol Cell 2021-06-08 [PMID: 34102106]
• Komulainen E, Badman J, Rey S et al. Parp1 hyperactivity couples DNA breaks to aberrant neuronal calcium signalling and lethal seizures EMBO reports 2021-05-05 [PMID: 33932076]
• Wu W, Hill SE, Nathan WJ et al. Neuronal enhancers are hotspots for DNA single-strand break repair Nature 2021-05-20 [PMID: 33767446] (IP, WB)

Bioinformatics

• Gene Symbol: XRCC1