Genetic Strategies: Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented
Genetic Strategies: Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
XRCC1 assembles protein complexes that regulate PARP1 activity, NAD+ consumption, and trapping during BER(A) Levels of PARP1 auto-ribosylation detected as above in XRCC1−/− U2OS cell lines stably transfected with ...read more
XRCC1 suppresses endogenous PARP1 trapping during BER(A) PARP1 levels in cell-equivalent aliquots of soluble and chromatin-containing fractions of WT and XRCC1−/− RPE-1 cells, measured by western blotting. Cells ...read more
Endogenous PARP1 trapping impedes POL beta recruitment into chromatin during BER(A) PARP1, XRCC1, and POL beta levels in the soluble and chromatin-containing fractions (1:4 cell equivalents, respectively) of WT and ...read more
Novus Biologicals Rabbit XRCC1 Antibody - BSA Free (NBP1-87154) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-XRCC1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for XRCC1 Antibody - BSA Free
DNA repair protein XRCC1
RCC
X-ray repair complementing defective repair in Chinese hamster cells 1
X-ray repair cross-complementing protein 1
X-ray-repair, complementing defective, repair in Chinese hamster
Background
XRCC1 (X-ray cross complementing factor-1) is involved in DNA base excision repair. XRCC1 is a 70kDa protein that has been shown to be physically associated with other DNA repair enzymes, including poly (ADP-ribose) polymerase (PARP), DNA Ligase III and DNA polymerase beta. XRCC1 contains a BRCT domain (for BRCA1 carboxyl terminus) which was originally found in the tumor suppressor protein BRCA1. Recently, the BRCT domain has been shown to mediate the protein-protein interaction of XRCC1 and DNA Ligase III-a.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
PARP Antibody Assays aid both Apoptosis and Cancer Research The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our XRCC1 Antibody - BSA Free and receive a gift card or discount.