![Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Western-Blot-NBP1-87154-img0015.jpg "Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | XRCC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/APE-Antibody-(13B8E5C2)-Immunocytochemistry-Immunofluorescence-NB100-116-img0013.jpg)
![Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/APE-Antibody-(13B8E5C2)-Western-Blot-NB100-116-img0014.jpg)
![Chromatin Immunoprecipitation (ChIP): APE Antibody (13B8E5C2) [NB100-116] - Association of p53 and APE1 on p53-binding sites in p21 promoter. Re-ChIP analysis (first IP with alpha-APE1 and the second IP with alpha-p53 antibody) showing simultaneous recruitment of APE1 and p53 in control vs. EPE treated cells; *: p value <0.05 (n=2) calculated based on APE1/p53 enriched DNA from control vs. etoposide treated cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.](http://images.novusbio.com/images2/APE-Antibody-(13B8E5C2)-Chromatin-Immunoprecipitation-(ChIP)-NB100-116-img0015.jpg)
![Flow Cytometry: OGG1 Antibody [NB100-106] - An intracellular stain was performed on Jurkat Cells with NB100-106 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.](http://images.novusbio.com/images2/OGG1-Antibody-Flow-Cytometry-NB100-106-img0029.jpg)
![Immunohistochemistry: OGG1 Antibody [NB100-106] - Figure 5 IHC-P analysis of hOGG1 protein expression in serous ovarian cancer: (A) Normal ovarian tissue treated with anti-hOGG1 antibody, biotinylated anti-rabbit IgG secondary antibody, and avidin-biotin-peroxidase complex, and counterstained with p-dimethylaminobenzaldehyde reagent (magnification 100 x); (B) serous cystadenoma with positive staining (magnification 200 x); (C) LG-SOC tissue with moderate positive staining (magnification 200 x); and (D) HG-SOC with negative staining (magnification 200 x). Black arrow pointed at the immunostained epithelial cells. Image collected and cropped by CiteAb from the following publication (http://ovarianresearch.biomedcentral.com/articles/10.1186/1757-2215-6-74), licensed under a CC-BY licence.](http://images.novusbio.com/images2/OGG1-Antibody-Immunohistochemistry-NB100-106-img0032.jpg)
![Immunohistochemistry: OGG1 Antibody [NB100-106] - The H&E staining ((a)-(c)) and IHC staining for oxidative DNA damage, 8-oxo-dGuo ((d)-(g)), and DNA repair enzyme hOGG1 ((h)-(j)) in control subjects and tumor and nontumor lesions of BCC patients. Values given are mean +/- SD. The statistical significance of differences between the control and case and between adjacent epidermis and tumor lesions of BCC patients was evaluated by nonparametric variables with Kruskal-Wallis test followed by Dunnett's post hoc test. * P < 0.05, *P < 0.01, *P < 0.001 compared to control; ##P < 0.01, ###P < 0.001 compared to tumor lesions of BCC patients. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/omcl/2016/5934024/), licensed under a CC-BY licence.](http://images.novusbio.com/images2/OGG1-Antibody-Immunohistochemistry-NB100-106-img0033.jpg)
![Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/PARP-Antibody-(194C1439)---(Azide-Free)--Cleaved-Immunocytochemistry-Immunofluorescence-NBP2-27335-img0004.jpg)
![Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - Analysis using 293T lysates expressing PARP. Image from verified customer review.](http://images.novusbio.com/images2/PARP-Antibody-(194C1439)-[Azide-Free]-Western-Blot-NBP2-27335-img0002.jpg)
![Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, using this antibody. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.](http://images.novusbio.com/images2/PARP-Antibody-(194C1439)---(Azide-Free)--Cleaved-Western-Blot-NBP2-27335-img0003.jpg)
![Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).](http://images.novusbio.com/images2/GST-Epitope-Tag-Antibody-Western-Blot-NB600-326-img0001.jpg)
![Simple Western: GST Epitope Tag Antibody [NB600-326] - Simple Western lane view shows a specific band for GST Epitope Tag in 5 ng/ml of hUbiquitn-GST (left) & hISG15-GST (right) lysate(s). This experiment was performed under reducing conditions using the 12 - 230 kDa separation system.](http://images.novusbio.com/images2/GST-Epitope-Tag-Antibody-Simple-Western-NB600-326-img0004.jpg)
![Simple Western: GST Epitope Tag Antibody [NB600-326] - Electropherogram image(s) of corresponding Simple Western lane view. GST Epitope Tag antibody was used at 1:2000 dilution on hUbiquitn-GST (left) & hISG15-GST (right) lysate(s).](http://images.novusbio.com/images2/GST-Epitope-Tag-Antibody-Simple-Western-NB600-326-img0005.jpg)
![Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Flow-Cytometry-NB200-103-img0006.jpg)
![Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Flow-Cytometry-NB200-103-img0007.jpg)
![Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Flow-(Intracellular)-NB200-103-img0003.jpg)
![Immunohistochemistry: Von Hippel Lindau Antibody (1E1) [NBP2-45411] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/Von-Hippel-Lindau-Antibody-(1E1)-Immunohistochemistry-NBP2-45411-img0001.jpg)
![Immunohistochemistry: Von Hippel Lindau Antibody (1E1) [NBP2-45411] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/Von-Hippel-Lindau-Antibody-(1E1)-Immunohistochemistry-NBP2-45411-img0002.jpg)
![Immunohistochemistry: Von Hippel Lindau Antibody (1E1) [NBP2-45411] - Analysis of Human endometrium tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/Von-Hippel-Lindau-Antibody-(1E1)-Immunohistochemistry-NBP2-45411-img0003.jpg)
![Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP1-31133] - Paraffin-embedded hepatoma, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/TBP-like-protein-TLP-Antibody-Immunohistochemistry-Paraffin-NBP1-31133-img0002.jpg)
![Western Blot: TBP like protein TLP Antibody [NBP1-31133] - Sample (50 ug of whole cell lysate) A: mouse brain 12% SDS PAGE, antibody diluted at 1:500.](http://images.novusbio.com/images2/TBP-like-protein-TLP-Antibody-Western-Blot-NBP1-31133-img0003.jpg)
![Western Blot: TBP like protein TLP Antibody [NBP1-31133] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:2000.](http://images.novusbio.com/images2/TBP-like-protein-TLP-Antibody-Western-Blot-NBP1-31133-img0004.jpg)
![Immunohistochemistry-Paraffin: GSTT1 Antibody [NBP1-32733] - Human hepatoma. GSTT1 antibody dilution: 1:500. Antigen Retrieval: Trilogy&#8482; (EDTA based, pH 8.0) buffer, 15min.](http://images.novusbio.com/images2/GSTT1-Antibody-Immunohistochemistry-NBP1-32733-img0003.jpg)
![Western Blot: GSTT1 Antibody [NBP1-32733] - Sample (30 ug of whole cell lysate)A: Hep G2 10% SDS PAGE, antibody diluted at 1:1000.](http://images.novusbio.com/images2/GSTT1-Antibody-Western-Blot-NBP1-32733-img0004.jpg)
![Immunoprecipitation: GSTT1 Antibody [NBP1-32733] - Immunoprecipitation of GSTT1 protein from HepG2 whole cell extracts using 5 ug of GSTT1 antibody. Western blot analysis was performed using GSTT1 antibody. EasyBlot anti-Rabbit IgG was used as a secondary reagent.](http://images.novusbio.com/images2/GSTT1-Antibody-Immunoprecipitation-NBP1-32733-img0005.jpg)
![Flow Cytometry: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - An intracellular stain was performed on U-87 MG Cells with NB100-417 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG APC-conjugated Secondary Antibody, (R&D Systems, F0111).](http://images.novusbio.com/images2/Carbonic-Anhydrase-IX-CA9-Antibody-Flow-Cytometry-NB100-417-img0034.jpg)
![Immunoblotting: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Iron depletion and nitric oxide stress and Iron depletion induce the truncated VDAC1 form accumulation. (D) Total protein extracts were analyzed by immunoblotting using VDACs poly antibody and anti-HIF-1 alpha and -CAIX antibodies. (E) Immunoblotting was used to analyze total protein extracts using antibodies against the three VDAC isoforms. (F) HeLa cells were grown in hypoxia (Hx, 1% O2) conditions and transfected with iscu- or NC-siRNA for 3 days, or grown in normoxia (Nx, 21% O2), some treated with DFO for 16 h. Western Blots analyzed total proteins using VDACs poly antibody and anti-HIF-1 alpha, -CAIX, -ISCU antibodies. Citation: Ferecatu I, Canal F, Fabbri L, Mazure NM, Bouton C, Golinelli-Cohen M-P (2018) Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1 alpha activation. PLoS ONE 13(3): e0194782.](http://images.novusbio.com/images2/Carbonic-Anhydrase-IX-CA9-Antibody-Immunoblotting-NB100-417-img0037.jpg)
![Immunoblotting: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Hypoxias impact on proteins of the mitochondrial ISC assembly machinery. (A) Immunoblotting analyzed the total protein extracts from HeLa cells grown in normoxia (Nx, 21% O2) or hypoxia (Hx, 1% O2) conditions using VDACs poly antibody and anti-CAIX, -ISCU, -FXN, -NFS1, -HSC20 antibodies. Beta-Actin was used as loading control. Citation: Ferecatu I, Canal F, Fabbri L, Mazure NM, Bouton C, Golinelli-Cohen M-P (2018) Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1 alpha activation. PLoS ONE 13(3): e0194782.](http://images.novusbio.com/images2/Carbonic-Anhydrase-IX-CA9-Antibody-Immunoblotting-NB100-417-img0038.jpg)
| Publications using NBP1-87154 | Applications | Species |
|---|---|---|
| Demin A, Hirota K, Tsuda M et al. XRCC1 Prevents Toxic PARP1 Trapping During DNA Base Excision Repair SSRN Electronic Journal Dec 17 2020 | ||
| Komulainen E, Badman J, Rey S et al. Parp1 hyperactivity couples DNA breaks to aberrant neuronal calcium signalling and lethal seizures EMBO reports May 5 2021 [PMID: 33932076] |
Secondary Antibodies |
Isotype Controls |
Diseases for XRCC1 Antibody (NBP1-87154)Discover more about diseases related to XRCC1 Antibody (NBP1-87154).
| Pathways for XRCC1 Antibody (NBP1-87154)View related products by pathway.
|
PTMs for XRCC1 Antibody (NBP1-87154)Learn more about PTMs related to XRCC1 Antibody (NBP1-87154).
| Research Areas for XRCC1 Antibody (NBP1-87154)Find related products by research area.
|
|
PARP Antibody Assays aid both Apoptosis and Cancer Research The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | XRCC1 |
![Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Western-Blot-NBP1-87154-img0009.jpg "Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87154-img0007.jpg "Immunocytochemistry/Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-87154-img0013.jpg "Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.")
![Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Western-Blot-NBP1-87154-img0014.jpg "Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-87154-img0010.jpg "Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-87154-img0011.jpg "Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize2/XRCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-87154-img0012.jpg "Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.")
![Western Blot: XRCC3 Antibody [NB100-165] - Detection of XRCC3 (38 kDa) from HeLa cell extract using NB100-165 (1:2500). Lanes 1 and 2 contain HTC116 and Hela whole cell extracts, respectively.](http://images.novusbio.com/images2/XRCC3-Antibody-Western-Blot-NB100-165-img0004.jpg)
![Western Blot: XRCC3 Antibody [NB100-165] - (A) Human XRCC3 (hXRCC3) expression was down regulated by siRNA in human transofrmed fibroblasts. (B) XRCC3 was inactivated in human colon cancer cells by gene targeting [Yoshihara et all., 2004, EMBO J., 23 (3), 670-680]. hXRCC3 was detected by WB using XRCC3 antibody (NB100-165). The star indicates non-specific cross-reactivity of the antibody. Image provided by confirmed customer review.](http://images.novusbio.com/images2/XRCC3-Antibody-Western-Blot-NB100-165-img0005.jpg)
![Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.](http://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![N/A: TOR/mTOR [p Ser2448] Antibody [NB600-607]](http://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Anti-ERCC1 immunohistochemistry on whole sections of a lung squamous cell carcinoma, using Mab 8F1 and D-10 with CC1-mono and H2-60 protocols. Note increased cytosolic background with H2-60. Arrow: Necrotic centre. Arrowhead: Stromal axis. 100 A- original magnification. Image collected and cropped by Citeab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY licence.](http://images.novusbio.com/images2/ERCC1-Antibody-(8F1)-Immunohistochemistry-Paraffin-NB500-704-img0005.jpg)
![Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Cyto-histologic comparison of anti-ERCC1 immunoreactivity using the protocol 8F1 CC1-mono (top) or 8F1 H2-60 (bottom). Left: Pleural effusion sediment of lung adenocarcinoma. Right: thoracic lymph node. Arrow: Lymphocyte. Arrowhead: Streak of endothelial cells. Asterisk: Tumor cell cluster. 400 A- original magnification. Image collected and cropped by Citeab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY licence.](http://images.novusbio.com/images2/ERCC1-Antibody-(8F1)-Immunohistochemistry-Paraffin-NB500-704-img0004.jpg)
![Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Analysis of ERCC1 in human non-small cell lung cancer. Image courtesy of product review submitted by Alex Soltermann.](http://images.novusbio.com/images2/ERCC1-Antibody-(8F1)-Immunohistochemistry-Paraffin-NB500-704-img0002.jpg)
![Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Western-Blot-NBP2-16756-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16756-img0006.jpg)
![Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Paraffin-embedded rat fore brain dilution: 1:500.](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunohistochemistry-Paraffin-NBP2-16756-img0007.jpg)
![Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.](http://images.novusbio.com/images2/DNA-Ligase-III-Antibody-Immunohistochemistry-Paraffin-NBP1-87720-img0011.jpg)
![Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/images2/DNA-Ligase-III-Antibody-Immunohistochemistry-Paraffin-NBP1-87720-img0012.jpg)
![Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/images2/DNA-Ligase-III-Antibody-Immunohistochemistry-Paraffin-NBP1-87720-img0013.jpg)
![Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/TYRP1-Antibody-Western-Blot-NBP1-88370-img0011.jpg)
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0012.jpg)
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/images2/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/DNA-Polymerase-beta-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38600-img0004.jpg)
![Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining in human testis and liver tissues using anti-POLB antibody. Corresponding POLB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/DNA-Polymerase-beta-Antibody-Immunohistochemistry-Paraffin-NBP2-38600-img0006.jpg)
![Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/images2/DNA-Polymerase-beta-Antibody-Immunohistochemistry-Paraffin-NBP2-38600-img0005.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")