Home » XRCC1 » XRCC1 Antibodies » XRCC1 Antibody

XRCC1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
Genetic Strategies: Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

XRCC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Specificity
Specificity of human XRCC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XRCC1 Protein (NBP1-87154PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XRCC1 Antibody

  • DNA repair protein XRCC1
  • RCC
  • X-ray repair complementing defective repair in Chinese hamster cells 1
  • X-ray repair cross-complementing protein 1
  • X-ray-repair, complementing defective, repair in Chinese hamster

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

XPD Antibody
AF3296
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, CH-1 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat XPD Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3296) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XPD at approximately 100 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: APE Antibody (13B8E5C2) [NB100-116] - APE1 antibody was tested in human breast cancer xenograft using DAB with hematoxylin counterstain.
(3 Reviews)
(81 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
XRCC3 Antibody
NB100-165
Western Blot: XRCC3 Antibody [NB100-165] - (A) Human XRCC3 (hXRCC3) expression was down regulated by siRNA in human transofrmed fibroblasts. (B) XRCC3 was inactivated in human colon cancer cells by gene targeting [Yoshihara et all., 2004, EMBO J., 23 (3), 670-680]. hXRCC3 was detected by WB using XRCC3 antibody (NB100-165). The star indicates non-specific cross-reactivity of the antibody. Image provided by confirmed customer review.
Western Blot: XRCC3 Antibody [NB100-165] - Detection of XRCC3 (38 kDa) from HeLa cell extract using NB100-165 (1:2500). Lanes 1 and 2 contain HTC116 and Hela whole cell extracts, respectively.
(1 Review)
(13 Publications)
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP
OGG1 Antibody
NB100-106
Western Blot: OGG1 Antibody [NB100-106] - Analysis of Ogg1 recombinant protein using Ogg1 antibody at 1 ug/mL.
Immunocytochemistry/Immunofluorescence: OGG1 Antibody [NB100-106] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-hOgg1 [NB100-106] at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha Tubulin (DM1A) [NB100-690] was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: OGG1 Antibody [NB100-106] - Analysis of OGG1 in human skin tissues. Image courtesy of product review by Arash Javeri.
(4 Reviews)
(89 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(13 Reviews)
(244 Publications)
Species: Hu
PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(5 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
GST Epitope Tag
Antibody
NB600-326
Western Blot: GST Epitope Tag Antibody [NB600-326] - Analysis using the HRP conjugate of NB600-326. Detection of 1.0, 0.3, or 0.1 ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.2 ug/ml (1:5,000).
Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).
Western Blot: GST Epitope Tag Antibody [NB600-326] - Analysis using the Biotin conjugate of NB600-326. Detection of 0.1, 0.3, or 1.0 ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000). Detection: Streptavidin-HRP (0.1 ug/ml) and chemiluminescence with an exposure time of 60 seconds.
(2 Reviews)
(17 Publications)
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
TOR/mTOR Antibody
NB100-240
Western Blot: TOR/mTOR Antibody [NB100-240] - Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-mTOR antibody used for WB at 0.2 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TOR/mTOR Antibody [NB100-240] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. Affinity purified rabbit anti-mTOR antibody used for WB at 0.4 ug/ml (A) used for IP at 3 ug/mg lysate. mTOR was also immunoprecipitated by a previous lot of this antibody and by rabbit anti-mTOR antibodies NB100-241 and NB100-58821. For blotting immunoprecipitated mTOR, NB100-58821 was used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 minutes (B).
(6 Publications)
Species: Hu
Applications: WB, IHC, IP, ICC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Von Hippel Lindau
Antibody
NB100-485
Western Blot: Von Hippel Lindau Antibody [NB100-485] - 20 ug whole cell lysates (MCF7 human breast cancer cell line; K562 human leukemia cell line). Image from verified customer review.
Western Blot: Von Hippel Lindau Antibody [NB100-485] - Detection of VHL in human kidney samples (30 ug)using NB 100-485. ECL detection 10 seconds. Lane 1: 0.5 ug/ml primary Lane 2: 2 ug/ml
(4 Reviews)
(5 Publications)
Species: Hu
Applications: WB, IP
ERCC1 Antibody
(8F1)
NB500-704
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Formalin fixed paraffin embedded human tonsil stained with ERCC1 antibody.
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Analysis of ERCC1 in human non-small cell lung cancer. Image courtesy of product review submitted by Alex Soltermann.
(1 Review)
(15 Publications)
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DNA Ligase III
Antibody (1F3)
NBP1-41190
Western Blot: DNA Ligase III Antibody (1F3) [NBP1-41190] - Whole cell extracts (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with DNA ligase III antibody diluted by 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Western Blot: DNA Ligase III Antibody (1F3) [NBP1-41190] - A. 293T whole cell lysate/extract. B. A431 whole cell lysate/extract. C. HeLa whole cell lysate/extract. D. HepG2 whole cell lysate/extract. DNA ligase III dilution: 1:500 The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
(10 Publications)
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IP, PLA, B/N
TBP like protein
TLP Antibody
NBP1-31133
Western Blot: TBP like protein TLP Antibody [NBP1-31133] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:2000.
Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP1-31133] - NT2D1 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: TLP protein stained by TLP antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP1-31133] - Paraffin-embedded mouse lung. TLP antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TYRP1 Antibody
NBP1-88370
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GSTT1 Antibody
NBP1-32733
Western Blot: GSTT1 Antibody [NBP1-32733] - A. 50 ug mouse spleen lysate/extract 12 % SDS-PAGEGSTT1 antibody dilution: 1:500
Immunohistochemistry: GSTT1 Antibody [NBP1-32733] - Analysis of paraffin-embedded SW480 xenograft, using GSTT1 antibody at 1:500 dilution.
Western Blot: GSTT1 Antibody [NBP1-32733] - Sample (30 ug of whole cell lysate)A: Hep G2 10% SDS PAGE, antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
DNA Polymerase
beta Antibody
NBP2-38600
Western Blot: DNA Polymerase beta Antibody [NBP2-38600] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Carbonic Anhydrase
IX/CA9 Antibody
NB100-417
Immunohistochemistry-Paraffin: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - IHC analysis of a formain fixed paraffin embedded (FFPE) tissue section of human breast cancer using CAIX antibody at 1:1000 dilution. The primary antibody bound to CAIX antigens in the tissue section was detected using a HRP labeled secondary antibody and DAB reagent. Nuclei of the cells were counterstained with hematoxylin. This CAIX antibody generated an expected cytoplasmic staining of CAIX protein with an intense signal around the cellular membranes in tumor cores. The latter are more likely to be hypoxic in growing tumors which signifies that the observed CAIX staining is specific.
Western Blot: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Analysis in 1) HeLa, 2) MDA-MB-231 and 3) A549 whole cell lysates.
Immunocytochemistry/Immunofluorescence: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Immunofluorescence of human RCC tumor cryosections using NB100-417 (Panel A). Panel B shows staining with normal rabbit serum.
(4 Reviews)
(165 Publications)
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for XRCC1 Antibody (NBP1-87154) (0)

There are no publications for XRCC1 Antibody (NBP1-87154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRCC1 Antibody (NBP1-87154) (0)

There are no reviews for XRCC1 Antibody (NBP1-87154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XRCC1 Antibody (NBP1-87154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for XRCC1 Antibody (NBP1-87154)

Discover related pathways, diseases and genes to XRCC1 Antibody (NBP1-87154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XRCC1 Antibody (NBP1-87154)

Discover more about diseases related to XRCC1 Antibody (NBP1-87154).
 

Pathways for XRCC1 Antibody (NBP1-87154)

View related products by pathway.

PTMs for XRCC1 Antibody (NBP1-87154)

Learn more about PTMs related to XRCC1 Antibody (NBP1-87154).
 

Research Areas for XRCC1 Antibody (NBP1-87154)

Find related products by research area.

Blogs on XRCC1.

Check out the latest blog posts on XRCC1.
PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XRCC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol XRCC1