Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | XRCC1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-87154 | Applications | Species |
---|---|---|
Demin A, Hirota K, Tsuda M et al. XRCC1 Prevents Toxic PARP1 Trapping During DNA Base Excision Repair SSRN Electronic Journal Dec 17 2020 | ||
Komulainen E, Badman J, Rey S et al. Parp1 hyperactivity couples DNA breaks to aberrant neuronal calcium signalling and lethal seizures EMBO reports May 5 2021 [PMID: 33932076] |
Secondary Antibodies |
Isotype Controls |
Diseases for XRCC1 Antibody (NBP1-87154)Discover more about diseases related to XRCC1 Antibody (NBP1-87154).
| Pathways for XRCC1 Antibody (NBP1-87154)View related products by pathway.
|
PTMs for XRCC1 Antibody (NBP1-87154)Learn more about PTMs related to XRCC1 Antibody (NBP1-87154).
| Research Areas for XRCC1 Antibody (NBP1-87154)Find related products by research area.
|
PARP Antibody Assays aid both Apoptosis and Cancer Research The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | XRCC1 |