XRCC1 Antibody

Images

 
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XRCC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XRCC1 Protein (NBP1-87154PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XRCC1 Antibody

  • DNA repair protein XRCC1
  • RCC
  • X-ray repair complementing defective repair in Chinese hamster cells 1
  • X-ray repair cross-complementing protein 1
  • X-ray-repair, complementing defective, repair in Chinese hamster

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-485
Species: Hu
Applications: WB, IP
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, B/N, ICC/IF, IP, PLA
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for XRCC1 Antibody (NBP1-87154) (0)

There are no publications for XRCC1 Antibody (NBP1-87154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRCC1 Antibody (NBP1-87154) (0)

There are no reviews for XRCC1 Antibody (NBP1-87154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XRCC1 Antibody (NBP1-87154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XRCC1 Products

Bioinformatics Tool for XRCC1 Antibody (NBP1-87154)

Discover related pathways, diseases and genes to XRCC1 Antibody (NBP1-87154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XRCC1 Antibody (NBP1-87154)

Discover more about diseases related to XRCC1 Antibody (NBP1-87154).
 

Pathways for XRCC1 Antibody (NBP1-87154)

View related products by pathway.

PTMs for XRCC1 Antibody (NBP1-87154)

Learn more about PTMs related to XRCC1 Antibody (NBP1-87154).
 

Research Areas for XRCC1 Antibody (NBP1-87154)

Find related products by research area.

Blogs on XRCC1.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XRCC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC1