Home » XRCC1 » XRCC1 Antibodies » XRCC1 Antibody

XRCC1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented
Genetic Strategies: Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented
Immunocytochemistry/ Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
Genetic Strategies: Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in control (vector only transfected HEK293T lysate) and XRCC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

XRCC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Specificity
Specificity of human XRCC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XRCC1 Protein (NBP1-87154PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XRCC1 Antibody

  • DNA repair protein XRCC1
  • RCC
  • X-ray repair complementing defective repair in Chinese hamster cells 1
  • X-ray repair cross-complementing protein 1
  • X-ray-repair, complementing defective, repair in Chinese hamster

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

XPD Antibody
AF3296
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, CH-1 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat XPD Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3296) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XPD at approximately 100 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Knockdown Validated: APE Antibody (13B8E5C2) [NB100-116] - Repression of p21 by APE1 in p53-null cells and effect of ectopic p53 in this repression. Representative Western analysis of p53, APE1, p21 and alpha-Tubulin levels in the same HCT116p53null cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells stained NB100-116 (Green) detected with DyLight Fluor 488 conjugated anti-rabbit IgG secondary antibody. Nuclei are counterstained with Hoechst 33258 (Blue).
(3 Reviews)
(93 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
XRCC3 Antibody
NB100-165
Western Blot: XRCC3 Antibody [NB100-165] - (A) Human XRCC3 (hXRCC3) expression was down regulated by siRNA in human transofrmed fibroblasts. (B) XRCC3 was inactivated in human colon cancer cells by gene targeting [Yoshihara et all., 2004, EMBO J., 23 (3), 670-680]. hXRCC3 was detected by WB using XRCC3 antibody (NB100-165). The star indicates non-specific cross-reactivity of the antibody. Image provided by confirmed customer review.
Western Blot: XRCC3 Antibody [NB100-165] - Detection of XRCC3 (38 kDa) from HeLa cell extract using NB100-165 (1:2500). Lanes 1 and 2 contain HTC116 and Hela whole cell extracts, respectively.
(1 Review)
(13 Publications)
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP
OGG1 Antibody
NB100-106
Immunohistochemistry-Paraffin: OGG1 Antibody [NB100-106] - Analysis of OGG1 in human skin tissues. Image courtesy of product review by Arash Javeri.
Western Blot: OGG1 Antibody [NB100-106] - - Analysis of Ogg1 expression in Jurkat whole cell lysate.
Immunohistochemistry: OGG1 Antibody [NB100-106] - Figure 5 IHC-P analysis of hOGG1 protein expression in serous ovarian cancer: (A) Normal ovarian tissue treated with anti-hOGG1 antibody, biotinylated anti-rabbit IgG secondary antibody, and avidin-biotin-peroxidase complex, and counterstained with p-dimethylaminobenzaldehyde reagent (magnification 100 x); (B) serous cystadenoma with positive staining (magnification 200 x); (C) LG-SOC tissue with moderate positive staining (magnification 200 x); and (D) HG-SOC with negative staining (magnification 200 x). Black arrow pointed at the immunostained epithelial cells. Image collected and cropped by CiteAb from the following publication (http://ovarianresearch.biomedcentral.com/articles/10.1186/1757-2215-6-74), licensed under a CC-BY licence.
(5 Reviews)
(108 Publications)
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(7 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
GST Epitope Tag
Antibody
NB600-326
Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).
Simple Western: GST Epitope Tag Antibody [NB600-326] - Simple Western lane view shows a specific band for GST Epitope Tag in 5 ng/ml of hUbiquitn-GST (left) & hISG15-GST (right) lysate(s). This experiment was performed under reducing conditions using the 12 - 230 kDa separation system.
Simple Western: GST Epitope Tag Antibody [NB600-326] - Electropherogram image(s) of corresponding Simple Western lane view. GST Epitope Tag antibody was used at 1:2000 dilution on hUbiquitn-GST (left) & hISG15-GST (right) lysate(s).
(2 Reviews)
(15 Publications)
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
VEGF [HRP]
DVE00
(25 Reviews)
(513 Publications)
Species: Hu
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Von Hippel Lindau
Antibody
NB100-41384
Western Blot: Von Hippel Lindau Antibody [NB100-41384] - (0.01ug/ml) staining of Human Ovary lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Von Hippel Lindau Antibody [NB100-41384] - (5ug/ml) staining of Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
ELISA: Von Hippel Lindau Antibody [NB100-41384] - (1.5ug/ml) as the reporter with VHL antibody as the capture rabbit antibody (2.5ug/ml).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
ERCC1 Antibody
(8F1)
NB500-704
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Formalin fixed paraffin embedded human tonsil stained with ERCC1 antibody.
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Analysis of ERCC1 in human non-small cell lung cancer. Image courtesy of product review submitted by Alex Soltermann.
(1 Review)
(15 Publications)
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DNA Ligase III
Antibody
NBP1-87720
Western Blot: DNA Ligase III Antibody [NBP1-87720] - Analysis in human cell line A-549.
Immunocytochemistry/Immunofluorescence: DNA Ligase III Antibody [NBP1-87720] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Ligase III Antibody [NBP1-87720] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TBP like protein
TLP Antibody
NBP1-31133
Western Blot: TBP like protein TLP Antibody [NBP1-31133] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:2000.
Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP1-31133] - NT2D1 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: TLP protein stained by TLP antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP1-31133] - Paraffin-embedded mouse lung. TLP antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TYRP1 Antibody
NBP1-88370
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
GSTT1 Antibody
NBP1-32733
Western Blot: GSTT1 Antibody [NBP1-32733] - A. 50 ug mouse spleen lysate/extract 12 % SDS-PAGEGSTT1 antibody dilution: 1:500
Immunohistochemistry-Paraffin: GSTT1 Antibody [NBP1-32733] - Human hepatoma. GSTT1 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: GSTT1 Antibody [NBP1-32733] - Sample (30 ug of whole cell lysate)A: Hep G2 10% SDS PAGE, antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
DNA Polymerase
beta Antibody
NBP2-38600
Western Blot: DNA Polymerase beta Antibody [NBP2-38600] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Carbonic Anhydrase
IX/CA9 Antibody
NB100-417
Immunohistochemistry: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Images showing Carbonic Anhydrase IX/CA9 expression, pimonidazole, apoptosis and proliferation in SCCNij202.Carbonic Anhydrase IX/CA9 is expressed in hypoxic regions as assessed by pimonidazole staining (A), but is also observed in non-pimonidazole areas (B). Yet, most of Carbonic Anhydrase IX/CA9 is expressed in pimonidazole positive regions (C). Proliferation (BrdUrd) and apoptosis (caspase-3) in relation to Carbonic Anhydrase IX/CA9 expression are shown in figure D and E. Red, Carbonic Anhydrase IX/CA9; Green, pimonidazole (A-B), BrdUrd (D) or caspase-3 (E); Yellow, overlap of Carbonic Anhydrase IX/CA9 (red) and pimonidazole (green); Light blue, vessels. Magnification 100x. Scale bars represent 100 um. Closed circles represent Carbonic Anhydrase IX/CA9 expression in pimonidazole positive regions; open circles represent Carbonic Anhydrase IX/CA9 expression in pimonidazole negative regions. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0108068), licensed under a CC-BY licence.
Dual RNAscope ISH-IHC: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Formalin-fixed paraffin-embedded tissue sections of human stomach were probed for Carbonic Anhydrase IX/CA9 mRNA (ACD RNAScope Probe, catalog # 559348; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Rabbit Polyclonal (Novus catalog # NB100-417) at 1:1000 dilution with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
Western Blot: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Analysis on various human cell lysates. Specific bands were detected for Carbonic Anhydrase IX/CA9 in HEK-293 and A498 cell lines at a molecular weight of approximately 50 kDa. WB image submitted by a verified customer review.
(6 Reviews)
(200 Publications)
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
XRCC1 Antibody
NBP1-87154
XRCC1 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for XRCC1 Antibody (NBP1-87154) (0)

There are no publications for XRCC1 Antibody (NBP1-87154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRCC1 Antibody (NBP1-87154) (0)

There are no reviews for XRCC1 Antibody (NBP1-87154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XRCC1 Antibody (NBP1-87154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional XRCC1 Products

Bioinformatics Tool for XRCC1 Antibody (NBP1-87154)

Discover related pathways, diseases and genes to XRCC1 Antibody (NBP1-87154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XRCC1 Antibody (NBP1-87154)

Discover more about diseases related to XRCC1 Antibody (NBP1-87154).
 

Pathways for XRCC1 Antibody (NBP1-87154)

View related products by pathway.

PTMs for XRCC1 Antibody (NBP1-87154)

Learn more about PTMs related to XRCC1 Antibody (NBP1-87154).
 

Research Areas for XRCC1 Antibody (NBP1-87154)

Find related products by research area.

Blogs on XRCC1.

Check out the latest blog posts on XRCC1.
PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XRCC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol XRCC1