Vinculin Antibody

Images

 
Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in human heart tissue.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vinculin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI
Marker
Focal Adhesion Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vinculin Recombinant Protein Antigen (NBP1-87495PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vinculin Antibody

  • CMD1W
  • CMH15
  • metavinculin
  • MVCL
  • VCL
  • Vinculin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-07463
Species: Hu
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00001446-D01P
Species: Hu, Mu
Applications: WB
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87495
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Vinculin Antibody (NBP1-87495) (0)

There are no publications for Vinculin Antibody (NBP1-87495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vinculin Antibody (NBP1-87495) (0)

There are no reviews for Vinculin Antibody (NBP1-87495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vinculin Antibody (NBP1-87495). (Showing 1 - 1 of 1 FAQ).

  1. Do you have any 100 coda or bigger controls?
    • I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

Secondary Antibodies

 

Isotype Controls

Additional Vinculin Products

Bioinformatics Tool for Vinculin Antibody (NBP1-87495)

Discover related pathways, diseases and genes to Vinculin Antibody (NBP1-87495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vinculin Antibody (NBP1-87495)

Discover more about diseases related to Vinculin Antibody (NBP1-87495).
 

Pathways for Vinculin Antibody (NBP1-87495)

View related products by pathway.

PTMs for Vinculin Antibody (NBP1-87495)

Learn more about PTMs related to Vinculin Antibody (NBP1-87495).
 

Research Areas for Vinculin Antibody (NBP1-87495)

Find related products by research area.

Blogs on Vinculin

There are no specific blogs for Vinculin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vinculin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VCL
Entrez