Vinculin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Analysis in human smooth muscle and cerebral cortex tissues using NBP1-87495 antibody. Corresponding VCL RNA-seq data are ...read more
Genetic Strategies: Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VCL antibody. Remaining relative ...read more
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Stainig of human cerebral cortex shows no positivity in neuronal cells.
Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in human heart tissue.
Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Stainig of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human testis shows strong cytoplasmic postivity in cells in seminiferious ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vinculin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI
Marker
Focal Adhesion Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vinculin Recombinant Protein Antigen (NBP1-87495PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vinculin Antibody

  • CMD1W
  • CMH15
  • metavinculin
  • MVCL
  • VCL
  • Vinculin

Background

Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Vinculin Antibody (NBP1-87495) (0)

There are no publications for Vinculin Antibody (NBP1-87495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vinculin Antibody (NBP1-87495) (0)

There are no reviews for Vinculin Antibody (NBP1-87495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vinculin Antibody (NBP1-87495). (Showing 1 - 1 of 1 FAQ).

  1. Do you have any 100 coda or bigger controls?
    • I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

Secondary Antibodies

 

Isotype Controls

Additional Vinculin Products

Research Areas for Vinculin Antibody (NBP1-87495)

Find related products by research area.

Blogs on Vinculin

There are no specific blogs for Vinculin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vinculin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VCL