Vinculin Antibody

Images

 
Genetic Strategies: Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VCL antibody. Remaining relative ...read more
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Stainig of human cerebral cortex shows no positivity in neuronal cells.
Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in human heart tissue.
Western Blot: Vinculin Antibody [NBP1-87495] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Analysis in human smooth muscle and cerebral cortex tissues using NBP1-87495 antibody. Corresponding VCL RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Stainig of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Vinculin Antibody [NBP1-87495] - Staining of human testis shows strong cytoplasmic postivity in cells in seminiferious ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vinculin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI
Marker
Focal Adhesion Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vinculin Recombinant Protein Antigen (NBP1-87495PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vinculin Antibody

  • CMD1W
  • CMH15
  • metavinculin
  • MVCL
  • VCL
  • Vinculin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP3-05251
Species: Hu, Mu
Applications: WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-91150
Species: Hu
Applications: IHC, IHC-P
NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00007791-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB

Publications for Vinculin Antibody (NBP1-87495) (0)

There are no publications for Vinculin Antibody (NBP1-87495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vinculin Antibody (NBP1-87495) (0)

There are no reviews for Vinculin Antibody (NBP1-87495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vinculin Antibody (NBP1-87495). (Showing 1 - 1 of 1 FAQ).

  1. Do you have any 100 coda or bigger controls?
    • I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

Secondary Antibodies

 

Isotype Controls

Additional Vinculin Products

Bioinformatics Tool for Vinculin Antibody (NBP1-87495)

Discover related pathways, diseases and genes to Vinculin Antibody (NBP1-87495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vinculin Antibody (NBP1-87495)

Discover more about diseases related to Vinculin Antibody (NBP1-87495).
 

Pathways for Vinculin Antibody (NBP1-87495)

View related products by pathway.

PTMs for Vinculin Antibody (NBP1-87495)

Learn more about PTMs related to Vinculin Antibody (NBP1-87495).
 

Research Areas for Vinculin Antibody (NBP1-87495)

Find related products by research area.

Blogs on Vinculin

There are no specific blogs for Vinculin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vinculin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VCL