| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CSN1S1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-55090 | Applications | Species |
|---|---|---|
| Langille E In vivo Screening Reveals Epigenetic Regulation of Mammary Epithelial Lineage Integrity and Tumorigenesis Thesis 2023-01-01 | ||
| E Langille, KN Al-Zahrani, Z Ma, M Liang, L Uuskula-Re, R Espin, K Teng, A Malik, H Bergholtz, S El Ghamras, S Afiuni-Zad, R Tsai, S Alvi, A Elia, Y Lu, RH Oh, KJ Kozma, D Trcka, M Narimatsu, JC Liu, T Nguyen, S Barutcu, SK Loganathan, R Bremner, GD Bader, SE Egan, DW Cescon, T Sorlie, JL Wrana, HW Jackson, MD Wilson, AK Witkiewicz, ES Knudsen, MA Pujana, GM Wahl, D Schramek Loss of epigenetic regulation disrupts lineage integrity, induces aberrant alveogenesis and promotes breast cancer Cancer Discovery, 2022-12-02;0(0):. 2022-12-02 [PMID: 36108220] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Casein Antibody (NBP2-55090)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CSN1S1 |