VASP Antibody

Images

 
Western Blot: VASP Antibody [NBP1-85792] - Analysis in human cell line HEL.
Immunocytochemistry/ Immunofluorescence: VASP Antibody [NBP1-85792] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: VASP Antibody [NBP1-85792] - Staining in human small intestine and skeletal muscle tissues using anti-VASP antibody. Corresponding VASP RNA-seq data are ...read more
Western Blot: VASP Antibody [NBP1-85792] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Western Blot: VASP Antibody [NBP1-85792] - Analysis in human cell lines U-251MG and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: VASP Antibody [NBP1-85792] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: VASP Antibody [NBP1-85792] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

VASP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
Marker
Focal Adhesion Marker
Specificity
Specificity of human, mouse, rat VASP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VASP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VASP Protein (NBP1-85792PEP)
Publications
Read Publication using NBP1-85792.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%). Reactivity reported in scientific literature (PMID: 22361696)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VASP Antibody

  • vasodilator-stimulated phosphoprotein
  • VASP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78249
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-14843
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-2307
Species: Hu
Applications: WB
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03254
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for VASP Antibody (NBP1-85792)(1)

Reviews for VASP Antibody (NBP1-85792) (0)

There are no reviews for VASP Antibody (NBP1-85792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VASP Antibody (NBP1-85792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VASP Products

Bioinformatics Tool for VASP Antibody (NBP1-85792)

Discover related pathways, diseases and genes to VASP Antibody (NBP1-85792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VASP Antibody (NBP1-85792)

Discover more about diseases related to VASP Antibody (NBP1-85792).
 

Pathways for VASP Antibody (NBP1-85792)

View related products by pathway.

PTMs for VASP Antibody (NBP1-85792)

Learn more about PTMs related to VASP Antibody (NBP1-85792).

Blogs on VASP

There are no specific blogs for VASP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VASP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VASP
Entrez